Anti PKNOX2 pAb (ATL-HPA055368)

Atlas Antibodies

Catalog No.:
ATL-HPA055368-25
Shipping:
Calculated at Checkout
$478.00
Adding to cart… The item has been added
Protein Description: PBX/knotted 1 homeobox 2
Gene Name: PKNOX2
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000035934: 98%, ENSRNOG00000028856: 98%
Entrez Gene ID: 63876
Uniprot ID: Q96KN3
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen DASNPDPAPKAKKIKSQHRPTQRFWPNSIAAGVLQQQGGAPGTNPDGSINLDNLQSLS
Gene Sequence DASNPDPAPKAKKIKSQHRPTQRFWPNSIAAGVLQQQGGAPGTNPDGSINLDNLQSLS
Gene ID - Mouse ENSMUSG00000035934
Gene ID - Rat ENSRNOG00000028856
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti PKNOX2 pAb (ATL-HPA055368)
Datasheet Anti PKNOX2 pAb (ATL-HPA055368) Datasheet (External Link)
Vendor Page Anti PKNOX2 pAb (ATL-HPA055368) at Atlas Antibodies

Documents & Links for Anti PKNOX2 pAb (ATL-HPA055368)
Datasheet Anti PKNOX2 pAb (ATL-HPA055368) Datasheet (External Link)
Vendor Page Anti PKNOX2 pAb (ATL-HPA055368)