Anti PKNOX2 pAb (ATL-HPA055368)
Atlas Antibodies
- Catalog No.:
- ATL-HPA055368-25
- Shipping:
- Calculated at Checkout
$447.00
Gene Name: PKNOX2
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000035934: 98%, ENSRNOG00000028856: 98%
Entrez Gene ID: 63876
Uniprot ID: Q96KN3
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | ICC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | DASNPDPAPKAKKIKSQHRPTQRFWPNSIAAGVLQQQGGAPGTNPDGSINLDNLQSLS |
Gene Sequence | DASNPDPAPKAKKIKSQHRPTQRFWPNSIAAGVLQQQGGAPGTNPDGSINLDNLQSLS |
Gene ID - Mouse | ENSMUSG00000035934 |
Gene ID - Rat | ENSRNOG00000028856 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti PKNOX2 pAb (ATL-HPA055368) | |
Datasheet | Anti PKNOX2 pAb (ATL-HPA055368) Datasheet (External Link) |
Vendor Page | Anti PKNOX2 pAb (ATL-HPA055368) at Atlas Antibodies |
Documents & Links for Anti PKNOX2 pAb (ATL-HPA055368) | |
Datasheet | Anti PKNOX2 pAb (ATL-HPA055368) Datasheet (External Link) |
Vendor Page | Anti PKNOX2 pAb (ATL-HPA055368) |