Anti PKNOX1 pAb (ATL-HPA057215)
Atlas Antibodies
- Catalog No.:
- ATL-HPA057215-25
- Shipping:
- Calculated at Checkout
$447.00
Gene Name: PKNOX1
Alternative Gene Name: PREP1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000006705: 98%, ENSRNOG00000001184: 98%
Entrez Gene ID: 5316
Uniprot ID: P55347
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | ICC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | ATQTLSIDSYQDGQQMQVVTELKTEQDPNCSEPDAEGVSPP |
Gene Sequence | ATQTLSIDSYQDGQQMQVVTELKTEQDPNCSEPDAEGVSPP |
Gene ID - Mouse | ENSMUSG00000006705 |
Gene ID - Rat | ENSRNOG00000001184 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti PKNOX1 pAb (ATL-HPA057215) | |
Datasheet | Anti PKNOX1 pAb (ATL-HPA057215) Datasheet (External Link) |
Vendor Page | Anti PKNOX1 pAb (ATL-HPA057215) at Atlas Antibodies |
Documents & Links for Anti PKNOX1 pAb (ATL-HPA057215) | |
Datasheet | Anti PKNOX1 pAb (ATL-HPA057215) Datasheet (External Link) |
Vendor Page | Anti PKNOX1 pAb (ATL-HPA057215) |