Anti PITPNM2 pAb (ATL-HPA003414)

Atlas Antibodies

Catalog No.:
ATL-HPA003414-25
Shipping:
Calculated at Checkout
$478.00
Adding to cart… The item has been added
Protein Description: phosphatidylinositol transfer protein, membrane-associated 2
Gene Name: PITPNM2
Alternative Gene Name: NIR3, RDGB2, RDGBA2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000029406: 86%, ENSRNOG00000029260: 86%
Entrez Gene ID: 57605
Uniprot ID: Q9BZ72
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen PKDITKWSSNDLMDKIESPEPEDTQDGLYRQGAPEFRVASSVEQLNIIEDEVSQPLAAPPSKIHVLLLVLHGGTILDTGAGDPSSKKGDANTIANVFDTVMRVHYPSALGRLAIRLVPCPPVCSDAFALVSN
Gene Sequence PKDITKWSSNDLMDKIESPEPEDTQDGLYRQGAPEFRVASSVEQLNIIEDEVSQPLAAPPSKIHVLLLVLHGGTILDTGAGDPSSKKGDANTIANVFDTVMRVHYPSALGRLAIRLVPCPPVCSDAFALVSN
Gene ID - Mouse ENSMUSG00000029406
Gene ID - Rat ENSRNOG00000029260
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti PITPNM2 pAb (ATL-HPA003414)
Datasheet Anti PITPNM2 pAb (ATL-HPA003414) Datasheet (External Link)
Vendor Page Anti PITPNM2 pAb (ATL-HPA003414) at Atlas Antibodies

Documents & Links for Anti PITPNM2 pAb (ATL-HPA003414)
Datasheet Anti PITPNM2 pAb (ATL-HPA003414) Datasheet (External Link)
Vendor Page Anti PITPNM2 pAb (ATL-HPA003414)
Citations for Anti PITPNM2 pAb (ATL-HPA003414) – 1 Found
Stadler, Charlotte; Hjelmare, Martin; Neumann, Beate; Jonasson, Kalle; Pepperkok, Rainer; Uhlén, Mathias; Lundberg, Emma. Systematic validation of antibody binding and protein subcellular localization using siRNA and confocal microscopy. Journal Of Proteomics. 2012;75(7):2236-51.  PubMed