Anti PITPNM1 pAb (ATL-HPA062757)
Atlas Antibodies
- Catalog No.:
- ATL-HPA062757-25
- Shipping:
- Calculated at Checkout
$303.00
Gene Name: PITPNM1
Alternative Gene Name: DRES9, NIR2, PITPNM, Rd9, RDGB, RDGB1, RDGBA1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000097096: 83%, ENSRNOG00000018553: 83%
Entrez Gene ID: 9600
Uniprot ID: O00562
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | ICC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | SRRGSMNNELLSPEFGPVRDPLADGVEGLGRGSPEPSALPPQRIPSDMASPEPEGSQNSLQAA |
Gene Sequence | SRRGSMNNELLSPEFGPVRDPLADGVEGLGRGSPEPSALPPQRIPSDMASPEPEGSQNSLQAA |
Gene ID - Mouse | ENSMUSG00000097096 |
Gene ID - Rat | ENSRNOG00000018553 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti PITPNM1 pAb (ATL-HPA062757) | |
Datasheet | Anti PITPNM1 pAb (ATL-HPA062757) Datasheet (External Link) |
Vendor Page | Anti PITPNM1 pAb (ATL-HPA062757) at Atlas Antibodies |
Documents & Links for Anti PITPNM1 pAb (ATL-HPA062757) | |
Datasheet | Anti PITPNM1 pAb (ATL-HPA062757) Datasheet (External Link) |
Vendor Page | Anti PITPNM1 pAb (ATL-HPA062757) |