Anti PITPNM1 pAb (ATL-HPA062757)

Atlas Antibodies

Catalog No.:
ATL-HPA062757-25
Shipping:
Calculated at Checkout
$303.00
Adding to cart… The item has been added
Protein Description: phosphatidylinositol transfer protein, membrane-associated 1
Gene Name: PITPNM1
Alternative Gene Name: DRES9, NIR2, PITPNM, Rd9, RDGB, RDGB1, RDGBA1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000097096: 83%, ENSRNOG00000018553: 83%
Entrez Gene ID: 9600
Uniprot ID: O00562
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen SRRGSMNNELLSPEFGPVRDPLADGVEGLGRGSPEPSALPPQRIPSDMASPEPEGSQNSLQAA
Gene Sequence SRRGSMNNELLSPEFGPVRDPLADGVEGLGRGSPEPSALPPQRIPSDMASPEPEGSQNSLQAA
Gene ID - Mouse ENSMUSG00000097096
Gene ID - Rat ENSRNOG00000018553
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti PITPNM1 pAb (ATL-HPA062757)
Datasheet Anti PITPNM1 pAb (ATL-HPA062757) Datasheet (External Link)
Vendor Page Anti PITPNM1 pAb (ATL-HPA062757) at Atlas Antibodies

Documents & Links for Anti PITPNM1 pAb (ATL-HPA062757)
Datasheet Anti PITPNM1 pAb (ATL-HPA062757) Datasheet (External Link)
Vendor Page Anti PITPNM1 pAb (ATL-HPA062757)