Anti PITPNM1 pAb (ATL-HPA060227)

Atlas Antibodies

SKU: ATL-HPA060227-25

• 
• 
• 

Protein Description: phosphatidylinositol transfer protein, membrane-associated 1
Gene Name: PITPNM1
Alternative Gene Name: DRES9, NIR2, PITPNM, Rd9, RDGB, RDGB1, RDGBA1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000097096: 82%, ENSRNOG00000018553: 81%
Entrez Gene ID: 9600
Uniprot ID: O00562
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: PKEMTKWNSNDFIDAFASPVEAEGTPEPGAEAAKGIEDGAQAPRDSEGLDGAGELGAEACAVHALFLILHSGNILDSGP
• Gene Sequence: PKEMTKWNSNDFIDAFASPVEAEGTPEPGAEAAKGIEDGAQAPRDSEGLDGAGELGAEACAVHALFLILHSGNILDSGP
• Gene ID - Mouse: ENSMUSG00000097096
• Gene ID - Rat: ENSRNOG00000018553
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.