Anti PITPNB pAb (ATL-HPA000528)
Atlas Antibodies
- Catalog No.:
- ATL-HPA000528-25
- Shipping:
- Calculated at Checkout
$478.00
Gene Name: PITPNB
Alternative Gene Name: VIB1B
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000050017: 99%, ENSRNOG00000000665: 99%
Entrez Gene ID: 23760
Uniprot ID: P48739
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | WB, ICC, IHC |
| Reactivity | Human, Mouse, Rat |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | CSVQEYQVGQLYSVAEASKNETGGGEGIEVLKNEPYEKDGEKGQYTHKIYHLKSKVPAFVRMIAPEGSLVFHEKAWNAYPYCRTIVTNEYMKDDFFIKIETWHKPDLGTLENVHGLDPNT |
| Gene Sequence | CSVQEYQVGQLYSVAEASKNETGGGEGIEVLKNEPYEKDGEKGQYTHKIYHLKSKVPAFVRMIAPEGSLVFHEKAWNAYPYCRTIVTNEYMKDDFFIKIETWHKPDLGTLENVHGLDPNT |
| Gene ID - Mouse | ENSMUSG00000050017 |
| Gene ID - Rat | ENSRNOG00000000665 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti PITPNB pAb (ATL-HPA000528) | |
| Datasheet | Anti PITPNB pAb (ATL-HPA000528) Datasheet (External Link) |
| Vendor Page | Anti PITPNB pAb (ATL-HPA000528) at Atlas Antibodies |
| Documents & Links for Anti PITPNB pAb (ATL-HPA000528) | |
| Datasheet | Anti PITPNB pAb (ATL-HPA000528) Datasheet (External Link) |
| Vendor Page | Anti PITPNB pAb (ATL-HPA000528) |