Anti PIR pAb (ATL-HPA000697 w/enhanced validation)

Atlas Antibodies

Catalog No.: ATL-HPA000697-25

Protein Description: pirin (iron-binding nuclear protein)
Gene Name: PIR
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000031379: 96%, ENSRNOG00000003674: 97%
Entrez Gene ID: 8544
Uniprot ID: O00625
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC, IHC
• Reactivity: Human, Rat
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: TVSYLLEGGSMAHEDFCGHTGKMNPGDLQWMTAGRGILHAEMPCSEEPAHGLQLWVNLRSSEKMVEPQYQELKSEEIPKPSKDGVTVAVISGEALGIKSKVYTRTPTLYLDF
• Gene Sequence: TVSYLLEGGSMAHEDFCGHTGKMNPGDLQWMTAGRGILHAEMPCSEEPAHGLQLWVNLRSSEKMVEPQYQELKSEEIPKPSKDGVTVAVISGEALGIKSKVYTRTPTLYLDF
• Gene ID - Mouse: ENSMUSG00000031379
• Gene ID - Rat: ENSRNOG00000003674
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti PIR pAb (ATL-HPA000697 w/enhanced validation) – 2 Found

Shubbar, Emman; Helou, Khalil; Kovács, Anikó; Nemes, Szilárd; Hajizadeh, Shahin; Enerbäck, Charlotta; Einbeigi, Zakaria. High levels of γ-glutamyl hydrolase (GGH) are associated with poor prognosis and unfavorable clinical outcomes in invasive breast cancer. Bmc Cancer. 2013;13( 23374458):47. 

Thomsen, Karina G; Terp, Mikkel G; Lund, Rikke R; Søkilde, Rolf; Elias, Daniel; Bak, Martin; Litman, Thomas; Beck, Hans C; Lyng, Maria B; Ditzel, Henrik J. miR-155, identified as anti-metastatic by global miRNA profiling of a metastasis model, inhibits cancer cell extravasation and colonization in vivo and causes significant signaling alterations. Oncotarget. 2015;6(30):29224-39.