Anti PIP5KL1 pAb (ATL-HPA056240)
Atlas Antibodies
- Catalog No.:
- ATL-HPA056240-25
- Shipping:
- Calculated at Checkout
$478.00
Gene Name: PIP5KL1
Alternative Gene Name: bA203J24.5, MGC46424
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000046854: 86%, ENSRNOG00000048676: 83%
Entrez Gene ID: 138429
Uniprot ID: Q5T9C9
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | ICC, IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | ISERYDIKGCEVSRWVDPAPEGSPLVLVLKDLNFQGKTINLGPQRSWFLRQMELDTTFLRELNVLDYSLLIAFQRLHE |
| Gene Sequence | ISERYDIKGCEVSRWVDPAPEGSPLVLVLKDLNFQGKTINLGPQRSWFLRQMELDTTFLRELNVLDYSLLIAFQRLHE |
| Gene ID - Mouse | ENSMUSG00000046854 |
| Gene ID - Rat | ENSRNOG00000048676 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti PIP5KL1 pAb (ATL-HPA056240) | |
| Datasheet | Anti PIP5KL1 pAb (ATL-HPA056240) Datasheet (External Link) |
| Vendor Page | Anti PIP5KL1 pAb (ATL-HPA056240) at Atlas Antibodies |
| Documents & Links for Anti PIP5KL1 pAb (ATL-HPA056240) | |
| Datasheet | Anti PIP5KL1 pAb (ATL-HPA056240) Datasheet (External Link) |
| Vendor Page | Anti PIP5KL1 pAb (ATL-HPA056240) |