Anti PIP4K2B pAb (ATL-HPA062220)

Atlas Antibodies

SKU: ATL-HPA062220-25

• 
• 

Protein Description: phosphatidylinositol-5-phosphate 4-kinase, type II, beta
Gene Name: PIP4K2B
Alternative Gene Name: PIP5K2B, PIP5KIIB, PIP5KIIbeta
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000018547: 100%, ENSRNOG00000013030: 100%
Entrez Gene ID: 8396
Uniprot ID: P78356
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: PDSPGNLLSFPRFFGPGEFDPSVDVYAMKSH
• Gene Sequence: PDSPGNLLSFPRFFGPGEFDPSVDVYAMKSH
• Gene ID - Mouse: ENSMUSG00000018547
• Gene ID - Rat: ENSRNOG00000013030
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.