Anti PIP4K2B pAb (ATL-HPA062220)
Atlas Antibodies
- Catalog No.:
- ATL-HPA062220-25
- Shipping:
- Calculated at Checkout
$423.00
Gene Name: PIP4K2B
Alternative Gene Name: PIP5K2B, PIP5KIIB, PIP5KIIbeta
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000018547: 100%, ENSRNOG00000013030: 100%
Entrez Gene ID: 8396
Uniprot ID: P78356
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | WB, ICC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | PDSPGNLLSFPRFFGPGEFDPSVDVYAMKSH |
| Gene Sequence | PDSPGNLLSFPRFFGPGEFDPSVDVYAMKSH |
| Gene ID - Mouse | ENSMUSG00000018547 |
| Gene ID - Rat | ENSRNOG00000013030 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti PIP4K2B pAb (ATL-HPA062220) | |
| Datasheet | Anti PIP4K2B pAb (ATL-HPA062220) Datasheet (External Link) |
| Vendor Page | Anti PIP4K2B pAb (ATL-HPA062220) at Atlas Antibodies |
| Documents & Links for Anti PIP4K2B pAb (ATL-HPA062220) | |
| Datasheet | Anti PIP4K2B pAb (ATL-HPA062220) Datasheet (External Link) |
| Vendor Page | Anti PIP4K2B pAb (ATL-HPA062220) |