Anti PIP4K2A pAb (ATL-HPA065440)
Atlas Antibodies
- Catalog No.:
- ATL-HPA065440-25
- Shipping:
- Calculated at Checkout
$324.00
Gene Name: PIP4K2A
Alternative Gene Name: PIP5K2A, PIP5KIIA, PIP5KIIalpha
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000026737: 94%, ENSRNOG00000016670: 94%
Entrez Gene ID: 5305
Uniprot ID: P48426
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | ICC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | PGNTLNSSPPLAPGEFDPNIDVYGIKCHENSPRKE |
| Gene Sequence | PGNTLNSSPPLAPGEFDPNIDVYGIKCHENSPRKE |
| Gene ID - Mouse | ENSMUSG00000026737 |
| Gene ID - Rat | ENSRNOG00000016670 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti PIP4K2A pAb (ATL-HPA065440) | |
| Datasheet | Anti PIP4K2A pAb (ATL-HPA065440) Datasheet (External Link) |
| Vendor Page | Anti PIP4K2A pAb (ATL-HPA065440) at Atlas Antibodies |
| Documents & Links for Anti PIP4K2A pAb (ATL-HPA065440) | |
| Datasheet | Anti PIP4K2A pAb (ATL-HPA065440) Datasheet (External Link) |
| Vendor Page | Anti PIP4K2A pAb (ATL-HPA065440) |