Anti PIP4K2A pAb (ATL-HPA065440)

Atlas Antibodies

Catalog No.: ATL-HPA065440-25

Protein Description: phosphatidylinositol-5-phosphate 4-kinase, type II, alpha
Gene Name: PIP4K2A
Alternative Gene Name: PIP5K2A, PIP5KIIA, PIP5KIIalpha
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000026737: 94%, ENSRNOG00000016670: 94%
Entrez Gene ID: 5305
Uniprot ID: P48426
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: PGNTLNSSPPLAPGEFDPNIDVYGIKCHENSPRKE
• Gene Sequence: PGNTLNSSPPLAPGEFDPNIDVYGIKCHENSPRKE
• Gene ID - Mouse: ENSMUSG00000026737
• Gene ID - Rat: ENSRNOG00000016670
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.