Anti PIP4K2A pAb (ATL-HPA065440)

Atlas Antibodies

Catalog No.:
ATL-HPA065440-25
Shipping:
Calculated at Checkout
$324.00
Adding to cart… The item has been added
Protein Description: phosphatidylinositol-5-phosphate 4-kinase, type II, alpha
Gene Name: PIP4K2A
Alternative Gene Name: PIP5K2A, PIP5KIIA, PIP5KIIalpha
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000026737: 94%, ENSRNOG00000016670: 94%
Entrez Gene ID: 5305
Uniprot ID: P48426
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen PGNTLNSSPPLAPGEFDPNIDVYGIKCHENSPRKE
Gene Sequence PGNTLNSSPPLAPGEFDPNIDVYGIKCHENSPRKE
Gene ID - Mouse ENSMUSG00000026737
Gene ID - Rat ENSRNOG00000016670
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti PIP4K2A pAb (ATL-HPA065440)
Datasheet Anti PIP4K2A pAb (ATL-HPA065440) Datasheet (External Link)
Vendor Page Anti PIP4K2A pAb (ATL-HPA065440) at Atlas Antibodies

Documents & Links for Anti PIP4K2A pAb (ATL-HPA065440)
Datasheet Anti PIP4K2A pAb (ATL-HPA065440) Datasheet (External Link)
Vendor Page Anti PIP4K2A pAb (ATL-HPA065440)