Anti PIP pAb (ATL-HPA009177 w/enhanced validation)
Atlas Antibodies
- Catalog No.:
- ATL-HPA009177-25
- Shipping:
- Calculated at Checkout
$423.00
Gene Name: PIP
Alternative Gene Name: GCDFP-15, GCDFP15, GPIP4
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000058499: 47%, ENSRNOG00000016076: 43%
Entrez Gene ID: 5304
Uniprot ID: P12273
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | WB, IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | FDIPKSVRPNDEVTAVLAVQTELKECMVVKTYLISSIPLQGAFNYKYTACLCDDNPKTFYWDFYTNRTVQIAAVVDVIRELGICPDDAAVIPIKNNRFYTIEILKVE |
| Gene Sequence | FDIPKSVRPNDEVTAVLAVQTELKECMVVKTYLISSIPLQGAFNYKYTACLCDDNPKTFYWDFYTNRTVQIAAVVDVIRELGICPDDAAVIPIKNNRFYTIEILKVE |
| Gene ID - Mouse | ENSMUSG00000058499 |
| Gene ID - Rat | ENSRNOG00000016076 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti PIP pAb (ATL-HPA009177 w/enhanced validation) | |
| Datasheet | Anti PIP pAb (ATL-HPA009177 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti PIP pAb (ATL-HPA009177 w/enhanced validation) at Atlas Antibodies |
| Documents & Links for Anti PIP pAb (ATL-HPA009177 w/enhanced validation) | |
| Datasheet | Anti PIP pAb (ATL-HPA009177 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti PIP pAb (ATL-HPA009177 w/enhanced validation) |
| Citations for Anti PIP pAb (ATL-HPA009177 w/enhanced validation) – 1 Found |
| Gambichler, T; Elfering, J; Meyer, T; Bruckmüller, S; Stockfleth, E; Skrygan, M; Käfferlein, H U; Brüning, T; Lang, K; Wagener, D; Schröder, S; Nick, M; Susok, L. Protein expression of prognostic genes in primary melanoma and benign nevi. Journal Of Cancer Research And Clinical Oncology. 2022;148(10):2673-2680. PubMed |