Anti PINLYP pAb (ATL-HPA061218)

Atlas Antibodies

SKU: ATL-HPA061218-25

• 
• 

Protein Description: phospholipase A2 inhibitor and LY6/PLAUR domain containing
Gene Name: PINLYP
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000011632: 47%, ENSRNOG00000019862: 47%
Entrez Gene ID: 390940
Uniprot ID: A6NC86
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: CTASFRDKCMGPMTHCTGKENHCVSLSGHVQAGIFKPRFAMRGCATESMCFTKPGAEVPTGTNVLFLHHIECTHS
• Gene Sequence: CTASFRDKCMGPMTHCTGKENHCVSLSGHVQAGIFKPRFAMRGCATESMCFTKPGAEVPTGTNVLFLHHIECTHS
• Gene ID - Mouse: ENSMUSG00000011632
• Gene ID - Rat: ENSRNOG00000019862
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.