Anti PINLYP pAb (ATL-HPA061218)

Atlas Antibodies

Catalog No.:
ATL-HPA061218-25
Shipping:
Calculated at Checkout
$478.00
Adding to cart… The item has been added
Protein Description: phospholipase A2 inhibitor and LY6/PLAUR domain containing
Gene Name: PINLYP
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000011632: 47%, ENSRNOG00000019862: 47%
Entrez Gene ID: 390940
Uniprot ID: A6NC86
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen CTASFRDKCMGPMTHCTGKENHCVSLSGHVQAGIFKPRFAMRGCATESMCFTKPGAEVPTGTNVLFLHHIECTHS
Gene Sequence CTASFRDKCMGPMTHCTGKENHCVSLSGHVQAGIFKPRFAMRGCATESMCFTKPGAEVPTGTNVLFLHHIECTHS
Gene ID - Mouse ENSMUSG00000011632
Gene ID - Rat ENSRNOG00000019862
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti PINLYP pAb (ATL-HPA061218)
Datasheet Anti PINLYP pAb (ATL-HPA061218) Datasheet (External Link)
Vendor Page Anti PINLYP pAb (ATL-HPA061218) at Atlas Antibodies

Documents & Links for Anti PINLYP pAb (ATL-HPA061218)
Datasheet Anti PINLYP pAb (ATL-HPA061218) Datasheet (External Link)
Vendor Page Anti PINLYP pAb (ATL-HPA061218)