Anti PIN4 pAb (ATL-HPA054483)
Atlas Antibodies
- Catalog No.:
- ATL-HPA054483-25
- Shipping:
- Calculated at Checkout
$303.00
Gene Name: PIN4
Alternative Gene Name: EPVH, PAR14, PAR17
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000079480: 70%, ENSRNOG00000050051: 70%
Entrez Gene ID: 5303
Uniprot ID: Q9Y237
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | ICC, IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | GLVRQLEQFRVQQQASKMPPKGKSGSGKAGKGGAASGSDSADKKAQGPKGGGNAVKVRHILCE |
Gene Sequence | GLVRQLEQFRVQQQASKMPPKGKSGSGKAGKGGAASGSDSADKKAQGPKGGGNAVKVRHILCE |
Gene ID - Mouse | ENSMUSG00000079480 |
Gene ID - Rat | ENSRNOG00000050051 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti PIN4 pAb (ATL-HPA054483) | |
Datasheet | Anti PIN4 pAb (ATL-HPA054483) Datasheet (External Link) |
Vendor Page | Anti PIN4 pAb (ATL-HPA054483) at Atlas Antibodies |
Documents & Links for Anti PIN4 pAb (ATL-HPA054483) | |
Datasheet | Anti PIN4 pAb (ATL-HPA054483) Datasheet (External Link) |
Vendor Page | Anti PIN4 pAb (ATL-HPA054483) |
Citations for Anti PIN4 pAb (ATL-HPA054483) – 1 Found |
Saeed, Umar; Piracha, Zahra Zahid. PIN1 and PIN4 inhibition via parvulin impeders Juglone, PiB, ATRA, 6,7,4'-THIF, KPT6566, and EGCG thwarted hepatitis B virus replication. Frontiers In Microbiology. 14( 36760500):921653. PubMed |