Anti PIN4 pAb (ATL-HPA054483)

Atlas Antibodies

Catalog No.:
ATL-HPA054483-25
Shipping:
Calculated at Checkout
$303.00
Adding to cart… The item has been added
Protein Description: protein (peptidylprolyl cis/trans isomerase) NIMA-interacting, 4 (parvulin)
Gene Name: PIN4
Alternative Gene Name: EPVH, PAR14, PAR17
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000079480: 70%, ENSRNOG00000050051: 70%
Entrez Gene ID: 5303
Uniprot ID: Q9Y237
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen GLVRQLEQFRVQQQASKMPPKGKSGSGKAGKGGAASGSDSADKKAQGPKGGGNAVKVRHILCE
Gene Sequence GLVRQLEQFRVQQQASKMPPKGKSGSGKAGKGGAASGSDSADKKAQGPKGGGNAVKVRHILCE
Gene ID - Mouse ENSMUSG00000079480
Gene ID - Rat ENSRNOG00000050051
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti PIN4 pAb (ATL-HPA054483)
Datasheet Anti PIN4 pAb (ATL-HPA054483) Datasheet (External Link)
Vendor Page Anti PIN4 pAb (ATL-HPA054483) at Atlas Antibodies

Documents & Links for Anti PIN4 pAb (ATL-HPA054483)
Datasheet Anti PIN4 pAb (ATL-HPA054483) Datasheet (External Link)
Vendor Page Anti PIN4 pAb (ATL-HPA054483)
Citations for Anti PIN4 pAb (ATL-HPA054483) – 1 Found
Saeed, Umar; Piracha, Zahra Zahid. PIN1 and PIN4 inhibition via parvulin impeders Juglone, PiB, ATRA, 6,7,4'-THIF, KPT6566, and EGCG thwarted hepatitis B virus replication. Frontiers In Microbiology. 14( 36760500):921653.  PubMed