Anti PIN4 pAb (ATL-HPA054483)
Atlas Antibodies
- Catalog No.:
- ATL-HPA054483-25
- Shipping:
- Calculated at Checkout
$324.00
Gene Name: PIN4
Alternative Gene Name: EPVH, PAR14, PAR17
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000079480: 70%, ENSRNOG00000050051: 70%
Entrez Gene ID: 5303
Uniprot ID: Q9Y237
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | ICC, IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | GLVRQLEQFRVQQQASKMPPKGKSGSGKAGKGGAASGSDSADKKAQGPKGGGNAVKVRHILCE |
| Gene Sequence | GLVRQLEQFRVQQQASKMPPKGKSGSGKAGKGGAASGSDSADKKAQGPKGGGNAVKVRHILCE |
| Gene ID - Mouse | ENSMUSG00000079480 |
| Gene ID - Rat | ENSRNOG00000050051 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti PIN4 pAb (ATL-HPA054483) | |
| Datasheet | Anti PIN4 pAb (ATL-HPA054483) Datasheet (External Link) |
| Vendor Page | Anti PIN4 pAb (ATL-HPA054483) at Atlas Antibodies |
| Documents & Links for Anti PIN4 pAb (ATL-HPA054483) | |
| Datasheet | Anti PIN4 pAb (ATL-HPA054483) Datasheet (External Link) |
| Vendor Page | Anti PIN4 pAb (ATL-HPA054483) |
| Citations for Anti PIN4 pAb (ATL-HPA054483) – 1 Found |
| Saeed, Umar; Piracha, Zahra Zahid. PIN1 and PIN4 inhibition via parvulin impeders Juglone, PiB, ATRA, 6,7,4'-THIF, KPT6566, and EGCG thwarted hepatitis B virus replication. Frontiers In Microbiology. 14( 36760500):921653. PubMed |