Anti PIN1 pAb (ATL-HPA070887)
Atlas Antibodies
- Catalog No.:
- ATL-HPA070887-25
- Shipping:
- Calculated at Checkout
$423.00
Gene Name: PIN1
Alternative Gene Name: dod
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000032171: 89%, ENSRNOG00000020474: 91%
Entrez Gene ID: 5300
Uniprot ID: Q13526
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | ICC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | RSSGRVYYFNHITNASQWERPSGNSSSGGKNGQGEPARVRCSHLLVKHSQSRR |
| Gene Sequence | RSSGRVYYFNHITNASQWERPSGNSSSGGKNGQGEPARVRCSHLLVKHSQSRR |
| Gene ID - Mouse | ENSMUSG00000032171 |
| Gene ID - Rat | ENSRNOG00000020474 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti PIN1 pAb (ATL-HPA070887) | |
| Datasheet | Anti PIN1 pAb (ATL-HPA070887) Datasheet (External Link) |
| Vendor Page | Anti PIN1 pAb (ATL-HPA070887) at Atlas Antibodies |
| Documents & Links for Anti PIN1 pAb (ATL-HPA070887) | |
| Datasheet | Anti PIN1 pAb (ATL-HPA070887) Datasheet (External Link) |
| Vendor Page | Anti PIN1 pAb (ATL-HPA070887) |