Anti PIN1 pAb (ATL-HPA068650)

Atlas Antibodies

Catalog No.:
ATL-HPA068650-25
Shipping:
Calculated at Checkout
$423.00
Adding to cart… The item has been added
Protein Description: peptidylprolyl cis/trans isomerase, NIMA-interacting 1
Gene Name: PIN1
Alternative Gene Name: dod
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000032171: 98%, ENSRNOG00000020474: 100%
Entrez Gene ID: 5300
Uniprot ID: Q13526
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen ESLASQFSDCSSAKARGDLGAFSRGQMQKPFEDASFALRTGEMSGPVFTDSGIHIILRTE
Gene Sequence ESLASQFSDCSSAKARGDLGAFSRGQMQKPFEDASFALRTGEMSGPVFTDSGIHIILRTE
Gene ID - Mouse ENSMUSG00000032171
Gene ID - Rat ENSRNOG00000020474
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti PIN1 pAb (ATL-HPA068650)
Datasheet Anti PIN1 pAb (ATL-HPA068650) Datasheet (External Link)
Vendor Page Anti PIN1 pAb (ATL-HPA068650) at Atlas Antibodies

Documents & Links for Anti PIN1 pAb (ATL-HPA068650)
Datasheet Anti PIN1 pAb (ATL-HPA068650) Datasheet (External Link)
Vendor Page Anti PIN1 pAb (ATL-HPA068650)