Anti PIM3 pAb (ATL-HPA068758)

Atlas Antibodies

Catalog No.:
ATL-HPA068758-25
Shipping:
Calculated at Checkout
$478.00
Adding to cart… The item has been added
Protein Description: Pim-3 proto-oncogene, serine/threonine kinase
Gene Name: PIM3
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000035828: 96%, ENSRNOG00000000529: 61%
Entrez Gene ID: 415116
Uniprot ID: Q86V86
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen FGTVYAGSRIADGLPVAVKHVVKERVTEWGSLGGATVPLEVVLLR
Gene Sequence FGTVYAGSRIADGLPVAVKHVVKERVTEWGSLGGATVPLEVVLLR
Gene ID - Mouse ENSMUSG00000035828
Gene ID - Rat ENSRNOG00000000529
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti PIM3 pAb (ATL-HPA068758)
Datasheet Anti PIM3 pAb (ATL-HPA068758) Datasheet (External Link)
Vendor Page Anti PIM3 pAb (ATL-HPA068758) at Atlas Antibodies

Documents & Links for Anti PIM3 pAb (ATL-HPA068758)
Datasheet Anti PIM3 pAb (ATL-HPA068758) Datasheet (External Link)
Vendor Page Anti PIM3 pAb (ATL-HPA068758)