Anti PILRA pAb (ATL-HPA056132)
Atlas Antibodies
- Catalog No.:
- ATL-HPA056132-25
- Shipping:
- Calculated at Checkout
$303.00
Gene Name: PILRA
Alternative Gene Name: FDF03
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000089922: 50%, ENSRNOG00000033017: 57%
Entrez Gene ID: 29992
Uniprot ID: Q9UKJ1
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | ALSSSTSPRAPPSHRPLKSPQNETLYSVLK |
| Gene Sequence | ALSSSTSPRAPPSHRPLKSPQNETLYSVLK |
| Gene ID - Mouse | ENSMUSG00000089922 |
| Gene ID - Rat | ENSRNOG00000033017 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti PILRA pAb (ATL-HPA056132) | |
| Datasheet | Anti PILRA pAb (ATL-HPA056132) Datasheet (External Link) |
| Vendor Page | Anti PILRA pAb (ATL-HPA056132) at Atlas Antibodies |
| Documents & Links for Anti PILRA pAb (ATL-HPA056132) | |
| Datasheet | Anti PILRA pAb (ATL-HPA056132) Datasheet (External Link) |
| Vendor Page | Anti PILRA pAb (ATL-HPA056132) |