Anti PILRA pAb (ATL-HPA056132)

Atlas Antibodies

Catalog No.:
ATL-HPA056132-25
Shipping:
Calculated at Checkout
$324.00
Adding to cart… The item has been added
Protein Description: paired immunoglobin-like type 2 receptor alpha
Gene Name: PILRA
Alternative Gene Name: FDF03
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000089922: 50%, ENSRNOG00000033017: 57%
Entrez Gene ID: 29992
Uniprot ID: Q9UKJ1
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen ALSSSTSPRAPPSHRPLKSPQNETLYSVLK
Gene Sequence ALSSSTSPRAPPSHRPLKSPQNETLYSVLK
Gene ID - Mouse ENSMUSG00000089922
Gene ID - Rat ENSRNOG00000033017
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti PILRA pAb (ATL-HPA056132)
Datasheet Anti PILRA pAb (ATL-HPA056132) Datasheet (External Link)
Vendor Page Anti PILRA pAb (ATL-HPA056132) at Atlas Antibodies

Documents & Links for Anti PILRA pAb (ATL-HPA056132)
Datasheet Anti PILRA pAb (ATL-HPA056132) Datasheet (External Link)
Vendor Page Anti PILRA pAb (ATL-HPA056132)