Anti PIK3R5 pAb (ATL-HPA052412)
Atlas Antibodies
- Catalog No.:
- ATL-HPA052412-25
- Shipping:
- Calculated at Checkout
$447.00
Gene Name: PIK3R5
Alternative Gene Name: p101, P101-PI3K
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000020901: 93%, ENSRNOG00000023428: 92%
Entrez Gene ID: 23533
Uniprot ID: Q8WYR1
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | WB, ICC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | AISGRSRWSNLEKVCTSVNLNKACRKQEELDSSMEALTLNLTEVVKRQNSKSKKGFNQISTSQIKVDKVQIIGSNSCPFAVCLDQDERKILQSVVRCEVSPCYKP |
| Gene Sequence | AISGRSRWSNLEKVCTSVNLNKACRKQEELDSSMEALTLNLTEVVKRQNSKSKKGFNQISTSQIKVDKVQIIGSNSCPFAVCLDQDERKILQSVVRCEVSPCYKP |
| Gene ID - Mouse | ENSMUSG00000020901 |
| Gene ID - Rat | ENSRNOG00000023428 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti PIK3R5 pAb (ATL-HPA052412) | |
| Datasheet | Anti PIK3R5 pAb (ATL-HPA052412) Datasheet (External Link) |
| Vendor Page | Anti PIK3R5 pAb (ATL-HPA052412) at Atlas Antibodies |
| Documents & Links for Anti PIK3R5 pAb (ATL-HPA052412) | |
| Datasheet | Anti PIK3R5 pAb (ATL-HPA052412) Datasheet (External Link) |
| Vendor Page | Anti PIK3R5 pAb (ATL-HPA052412) |