Anti PIK3CG pAb (ATL-HPA069976)
Atlas Antibodies
- Catalog No.:
- ATL-HPA069976-25
- Shipping:
- Calculated at Checkout
$351.00
Gene Name: PIK3CG
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000020573: 93%, ENSRNOG00000009385: 93%
Entrez Gene ID: 5294
Uniprot ID: P48736
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | ICC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | KGKVQLLYYVNLLLIDHRFLLRRGEYVLHMWQISGKGEDQGSFNADKLTSATNPDKENSMSISILLDNYCHPIALPKHQPT |
| Gene Sequence | KGKVQLLYYVNLLLIDHRFLLRRGEYVLHMWQISGKGEDQGSFNADKLTSATNPDKENSMSISILLDNYCHPIALPKHQPT |
| Gene ID - Mouse | ENSMUSG00000020573 |
| Gene ID - Rat | ENSRNOG00000009385 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti PIK3CG pAb (ATL-HPA069976) | |
| Datasheet | Anti PIK3CG pAb (ATL-HPA069976) Datasheet (External Link) |
| Vendor Page | Anti PIK3CG pAb (ATL-HPA069976) at Atlas Antibodies |
| Documents & Links for Anti PIK3CG pAb (ATL-HPA069976) | |
| Datasheet | Anti PIK3CG pAb (ATL-HPA069976) Datasheet (External Link) |
| Vendor Page | Anti PIK3CG pAb (ATL-HPA069976) |