Anti PIK3CG pAb (ATL-HPA069976)
Atlas Antibodies
- Catalog No.:
- ATL-HPA069976-25
- Shipping:
- Calculated at Checkout
$328.00
Gene Name: PIK3CG
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000020573: 93%, ENSRNOG00000009385: 93%
Entrez Gene ID: 5294
Uniprot ID: P48736
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | ICC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | KGKVQLLYYVNLLLIDHRFLLRRGEYVLHMWQISGKGEDQGSFNADKLTSATNPDKENSMSISILLDNYCHPIALPKHQPT |
Gene Sequence | KGKVQLLYYVNLLLIDHRFLLRRGEYVLHMWQISGKGEDQGSFNADKLTSATNPDKENSMSISILLDNYCHPIALPKHQPT |
Gene ID - Mouse | ENSMUSG00000020573 |
Gene ID - Rat | ENSRNOG00000009385 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti PIK3CG pAb (ATL-HPA069976) | |
Datasheet | Anti PIK3CG pAb (ATL-HPA069976) Datasheet (External Link) |
Vendor Page | Anti PIK3CG pAb (ATL-HPA069976) at Atlas Antibodies |
Documents & Links for Anti PIK3CG pAb (ATL-HPA069976) | |
Datasheet | Anti PIK3CG pAb (ATL-HPA069976) Datasheet (External Link) |
Vendor Page | Anti PIK3CG pAb (ATL-HPA069976) |