Anti PIK3CB pAb (ATL-HPA064207)

Atlas Antibodies

Catalog No.:
ATL-HPA064207-25
Shipping:
Calculated at Checkout
$423.00
Adding to cart… The item has been added
Protein Description: phosphatidylinositol-4,5-bisphosphate 3-kinase, catalytic subunit beta
Gene Name: PIK3CB
Alternative Gene Name: PIK3C1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000032462: 87%, ENSRNOG00000016384: 87%
Entrez Gene ID: 5291
Uniprot ID: P42338
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen LSLVGLSWMDWLKQTYPPEHEPSIPENLEDKLYGGKLIVAVHFENCQDVFSFQVSPNMNPIKVNELAIQKRLTIHGK
Gene Sequence LSLVGLSWMDWLKQTYPPEHEPSIPENLEDKLYGGKLIVAVHFENCQDVFSFQVSPNMNPIKVNELAIQKRLTIHGK
Gene ID - Mouse ENSMUSG00000032462
Gene ID - Rat ENSRNOG00000016384
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti PIK3CB pAb (ATL-HPA064207)
Datasheet Anti PIK3CB pAb (ATL-HPA064207) Datasheet (External Link)
Vendor Page Anti PIK3CB pAb (ATL-HPA064207) at Atlas Antibodies

Documents & Links for Anti PIK3CB pAb (ATL-HPA064207)
Datasheet Anti PIK3CB pAb (ATL-HPA064207) Datasheet (External Link)
Vendor Page Anti PIK3CB pAb (ATL-HPA064207)