Anti PIH1D3 pAb (ATL-HPA072496 w/enhanced validation)

Atlas Antibodies

SKU:
ATL-HPA072496-25
  • Immunohistochemistry analysis in human fallopian tube and colon tissues using Anti-PIH1D3 antibody. Corresponding PIH1D3 RNA-seq data are presented for the same tissues.
Shipping:
Calculated at Checkout
$303.00
Adding to cart… The item has been added
Protein Description: PIH1 domain containing 3
Gene Name: PIH1D3
Alternative Gene Name: CXorf41, MGC35261, NYSAR97
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000042433: 55%, ENSRNOG00000054900: 52%
Entrez Gene ID: 139212
Uniprot ID: Q9NQM4
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen MDSENMKTENMESQNVDFESVSSVTALEALSKLLNPEEEDDSDYGQTNGLSTIGAMGPGNIGPP
Gene Sequence MDSENMKTENMESQNVDFESVSSVTALEALSKLLNPEEEDDSDYGQTNGLSTIGAMGPGNIGPP
Gene ID - Mouse ENSMUSG00000042433
Gene ID - Rat ENSRNOG00000054900
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.



Documents & Links for Anti PIH1D3 pAb (ATL-HPA072496 w/enhanced validation)
Datasheet Anti PIH1D3 pAb (ATL-HPA072496 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti PIH1D3 pAb (ATL-HPA072496 w/enhanced validation)



Citations for Anti PIH1D3 pAb (ATL-HPA072496 w/enhanced validation) – 1 Found
Liu, Zhen; Nguyen, Quynh P H; Guan, Qingxu; Albulescu, Alexandra; Erdman, Lauren; Mahdaviyeh, Yasaman; Kang, Jasmine; Ouyang, Hong; Hegele, Richard G; Moraes, Theo; Goldenberg, Anna; Dell, Sharon D; Mennella, Vito. A quantitative super-resolution imaging toolbox for diagnosis of motile ciliopathies. Science Translational Medicine. 2020;12(535)  PubMed