Anti PIH1D1 pAb (ATL-HPA047258)

Atlas Antibodies

Catalog No.:
ATL-HPA047258-25
Shipping:
Calculated at Checkout
$324.00
Adding to cart… The item has been added
Protein Description: PIH1 domain containing 1
Gene Name: PIH1D1
Alternative Gene Name: FLJ20643, NOP17
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000003423: 79%, ENSRNOG00000020634: 83%
Entrez Gene ID: 55011
Uniprot ID: Q9NWS0
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen MANPKLLGLELSEAEAIGADSARFEELLLQASKELQQAQTTRPESTQIQPQPGFCIKTNSSEGKVFINICHSPSIPPPADVTEEELLQMLEEDQAGFRIPMS
Gene Sequence MANPKLLGLELSEAEAIGADSARFEELLLQASKELQQAQTTRPESTQIQPQPGFCIKTNSSEGKVFINICHSPSIPPPADVTEEELLQMLEEDQAGFRIPMS
Gene ID - Mouse ENSMUSG00000003423
Gene ID - Rat ENSRNOG00000020634
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti PIH1D1 pAb (ATL-HPA047258)
Datasheet Anti PIH1D1 pAb (ATL-HPA047258) Datasheet (External Link)
Vendor Page Anti PIH1D1 pAb (ATL-HPA047258) at Atlas Antibodies

Documents & Links for Anti PIH1D1 pAb (ATL-HPA047258)
Datasheet Anti PIH1D1 pAb (ATL-HPA047258) Datasheet (External Link)
Vendor Page Anti PIH1D1 pAb (ATL-HPA047258)