Anti PIGZ pAb (ATL-HPA059920)
Atlas Antibodies
- Catalog No.:
- ATL-HPA059920-25
- Shipping:
- Calculated at Checkout
$447.00
Gene Name: PIGZ
Alternative Gene Name: FLJ12768, MGC52163, SMP3
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000045625: 80%, ENSRNOG00000047082: 78%
Entrez Gene ID: 80235
Uniprot ID: Q86VD9
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | APVEVVDMGGTEDWALCQTLKSFTRQPACQVAGGPWLCRLFVVTPGTTRRAVEKCSFPFKNETLLFPHLTLEDPPALSSL |
Gene Sequence | APVEVVDMGGTEDWALCQTLKSFTRQPACQVAGGPWLCRLFVVTPGTTRRAVEKCSFPFKNETLLFPHLTLEDPPALSSL |
Gene ID - Mouse | ENSMUSG00000045625 |
Gene ID - Rat | ENSRNOG00000047082 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti PIGZ pAb (ATL-HPA059920) | |
Datasheet | Anti PIGZ pAb (ATL-HPA059920) Datasheet (External Link) |
Vendor Page | Anti PIGZ pAb (ATL-HPA059920) at Atlas Antibodies |
Documents & Links for Anti PIGZ pAb (ATL-HPA059920) | |
Datasheet | Anti PIGZ pAb (ATL-HPA059920) Datasheet (External Link) |
Vendor Page | Anti PIGZ pAb (ATL-HPA059920) |