Anti PIGX pAb (ATL-HPA073301)

Atlas Antibodies

Catalog No.:
ATL-HPA073301-25
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: phosphatidylinositol glycan anchor biosynthesis class X
Gene Name: PIGX
Alternative Gene Name: FLJ20522
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000023791: 76%, ENSRNOG00000033623: 74%
Entrez Gene ID: 54965
Uniprot ID: Q8TBF5
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen DQEFPILKCWAHSEVAAPCALENEDICQWNKMKYKSVYKNVILQVPVGLT
Gene Sequence DQEFPILKCWAHSEVAAPCALENEDICQWNKMKYKSVYKNVILQVPVGLT
Gene ID - Mouse ENSMUSG00000023791
Gene ID - Rat ENSRNOG00000033623
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti PIGX pAb (ATL-HPA073301)
Datasheet Anti PIGX pAb (ATL-HPA073301) Datasheet (External Link)
Vendor Page Anti PIGX pAb (ATL-HPA073301) at Atlas Antibodies

Documents & Links for Anti PIGX pAb (ATL-HPA073301)
Datasheet Anti PIGX pAb (ATL-HPA073301) Datasheet (External Link)
Vendor Page Anti PIGX pAb (ATL-HPA073301)