Anti PIGX pAb (ATL-HPA029409 w/enhanced validation)

Atlas Antibodies

Catalog No.: ATL-HPA029409-25

Protein Description: phosphatidylinositol glycan anchor biosynthesis, class X
Gene Name: PIGX
Alternative Gene Name: FLJ20522
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000023791: 84%, ENSRNOG00000033623: 84%
Entrez Gene ID: 54965
Uniprot ID: Q8TBF5
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: MCSEIILRQEVLKDGFHRDLLIKVKFGESIEDLHTCRLLIKQDIPAGLYVDPYELASLRERNITEAVMVSENFDIEAPNYLSKESEVLIYARRDSQCIDCFQAFLPVHCRYHRPHSEDGEASIVVNNPDLLMFCD
• Gene Sequence: MCSEIILRQEVLKDGFHRDLLIKVKFGESIEDLHTCRLLIKQDIPAGLYVDPYELASLRERNITEAVMVSENFDIEAPNYLSKESEVLIYARRDSQCIDCFQAFLPVHCRYHRPHSEDGEASIVVNNPDLLMFCD
• Gene ID - Mouse: ENSMUSG00000023791
• Gene ID - Rat: ENSRNOG00000033623
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.