Anti PIGS pAb (ATL-HPA018149)

Atlas Antibodies

Catalog No.:
ATL-HPA018149-100
Shipping:
Calculated at Checkout
$638.00
Adding to cart… The item has been added
Protein Description: phosphatidylinositol glycan anchor biosynthesis, class S
Gene Name: PIGS
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000041958: 92%, ENSRNOG00000011366: 92%
Entrez Gene ID: 94005
Uniprot ID: Q96S52
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen SVLPVRVEVDMVRVMEVFLAQLRLLFGIAQPQLPPKCLLSGPTSEGLMTWELDRLLWARSVENLATATTTLTSLAQLLGKISNIVIKDDVASEVYKAVAAVQKSAEELASGHLASAFVASQEAVTSSELAFFDPSLLHLLYFPDDQ
Gene Sequence SVLPVRVEVDMVRVMEVFLAQLRLLFGIAQPQLPPKCLLSGPTSEGLMTWELDRLLWARSVENLATATTTLTSLAQLLGKISNIVIKDDVASEVYKAVAAVQKSAEELASGHLASAFVASQEAVTSSELAFFDPSLLHLLYFPDDQ
Gene ID - Mouse ENSMUSG00000041958
Gene ID - Rat ENSRNOG00000011366
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti PIGS pAb (ATL-HPA018149)
Datasheet Anti PIGS pAb (ATL-HPA018149) Datasheet (External Link)
Vendor Page Anti PIGS pAb (ATL-HPA018149) at Atlas Antibodies

Documents & Links for Anti PIGS pAb (ATL-HPA018149)
Datasheet Anti PIGS pAb (ATL-HPA018149) Datasheet (External Link)
Vendor Page Anti PIGS pAb (ATL-HPA018149)