Anti PIGM pAb (ATL-HPA047418)
Atlas Antibodies
- Catalog No.:
- ATL-HPA047418-25
- Shipping:
- Calculated at Checkout
$478.00
Gene Name: PIGM
Alternative Gene Name: GPI-MT-I
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000050229: 95%, ENSRNOG00000060604: 95%
Entrez Gene ID: 93183
Uniprot ID: Q9H3S5
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | QDRTLHVRYTDIDYQVFTDAARFVTEGRSPYLRATYRYT |
| Gene Sequence | QDRTLHVRYTDIDYQVFTDAARFVTEGRSPYLRATYRYT |
| Gene ID - Mouse | ENSMUSG00000050229 |
| Gene ID - Rat | ENSRNOG00000060604 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti PIGM pAb (ATL-HPA047418) | |
| Datasheet | Anti PIGM pAb (ATL-HPA047418) Datasheet (External Link) |
| Vendor Page | Anti PIGM pAb (ATL-HPA047418) at Atlas Antibodies |
| Documents & Links for Anti PIGM pAb (ATL-HPA047418) | |
| Datasheet | Anti PIGM pAb (ATL-HPA047418) Datasheet (External Link) |
| Vendor Page | Anti PIGM pAb (ATL-HPA047418) |