Anti PIGM pAb (ATL-HPA047418)

Atlas Antibodies

Catalog No.:
ATL-HPA047418-25
Shipping:
Calculated at Checkout
$478.00
Adding to cart… The item has been added
Protein Description: phosphatidylinositol glycan anchor biosynthesis, class M
Gene Name: PIGM
Alternative Gene Name: GPI-MT-I
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000050229: 95%, ENSRNOG00000060604: 95%
Entrez Gene ID: 93183
Uniprot ID: Q9H3S5
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen QDRTLHVRYTDIDYQVFTDAARFVTEGRSPYLRATYRYT
Gene Sequence QDRTLHVRYTDIDYQVFTDAARFVTEGRSPYLRATYRYT
Gene ID - Mouse ENSMUSG00000050229
Gene ID - Rat ENSRNOG00000060604
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti PIGM pAb (ATL-HPA047418)
Datasheet Anti PIGM pAb (ATL-HPA047418) Datasheet (External Link)
Vendor Page Anti PIGM pAb (ATL-HPA047418) at Atlas Antibodies

Documents & Links for Anti PIGM pAb (ATL-HPA047418)
Datasheet Anti PIGM pAb (ATL-HPA047418) Datasheet (External Link)
Vendor Page Anti PIGM pAb (ATL-HPA047418)