Anti PIGL pAb (ATL-HPA012739)

Atlas Antibodies

Catalog No.:
ATL-HPA012739-25
Shipping:
Calculated at Checkout
$478.00
Adding to cart… The item has been added
Protein Description: phosphatidylinositol glycan anchor biosynthesis, class L
Gene Name: PIGL
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000014245: 76%, ENSRNOG00000003070: 74%
Entrez Gene ID: 9487
Uniprot ID: Q9Y2B2
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen MKSREQGGRLGAESRTLLVIAHPDDEAMFFAPTVLGLARLRHWVYLLCFSAGNYYNQGETRKKELLQSCDVLGIPLSSVMIIDNRDFPDDPGMQWDTEHVARVLLQHIEVNGI
Gene Sequence MKSREQGGRLGAESRTLLVIAHPDDEAMFFAPTVLGLARLRHWVYLLCFSAGNYYNQGETRKKELLQSCDVLGIPLSSVMIIDNRDFPDDPGMQWDTEHVARVLLQHIEVNGI
Gene ID - Mouse ENSMUSG00000014245
Gene ID - Rat ENSRNOG00000003070
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti PIGL pAb (ATL-HPA012739)
Datasheet Anti PIGL pAb (ATL-HPA012739) Datasheet (External Link)
Vendor Page Anti PIGL pAb (ATL-HPA012739) at Atlas Antibodies

Documents & Links for Anti PIGL pAb (ATL-HPA012739)
Datasheet Anti PIGL pAb (ATL-HPA012739) Datasheet (External Link)
Vendor Page Anti PIGL pAb (ATL-HPA012739)