Anti PIGK pAb (ATL-HPA057040)

Atlas Antibodies

Catalog No.: ATL-HPA057040-25

Protein Description: phosphatidylinositol glycan anchor biosynthesis, class K
Gene Name: PIGK
Alternative Gene Name: GPI8, hGPI8
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000039047: 100%, ENSRNOG00000042359: 100%
Entrez Gene ID: 10026
Uniprot ID: Q92643
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: DTCQGASMYERFYSPNIMALASSQVGEDSLSHQPDPAIGVHLMDRYTFYVLEFLEEINPASQTNMNDLFQVCPKSL
• Gene Sequence: DTCQGASMYERFYSPNIMALASSQVGEDSLSHQPDPAIGVHLMDRYTFYVLEFLEEINPASQTNMNDLFQVCPKSL
• Gene ID - Mouse: ENSMUSG00000039047
• Gene ID - Rat: ENSRNOG00000042359
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.