Anti PIGK pAb (ATL-HPA057040)
Atlas Antibodies
- Catalog No.:
- ATL-HPA057040-25
- Shipping:
- Calculated at Checkout
$447.00
Gene Name: PIGK
Alternative Gene Name: GPI8, hGPI8
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000039047: 100%, ENSRNOG00000042359: 100%
Entrez Gene ID: 10026
Uniprot ID: Q92643
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | DTCQGASMYERFYSPNIMALASSQVGEDSLSHQPDPAIGVHLMDRYTFYVLEFLEEINPASQTNMNDLFQVCPKSL |
| Gene Sequence | DTCQGASMYERFYSPNIMALASSQVGEDSLSHQPDPAIGVHLMDRYTFYVLEFLEEINPASQTNMNDLFQVCPKSL |
| Gene ID - Mouse | ENSMUSG00000039047 |
| Gene ID - Rat | ENSRNOG00000042359 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti PIGK pAb (ATL-HPA057040) | |
| Datasheet | Anti PIGK pAb (ATL-HPA057040) Datasheet (External Link) |
| Vendor Page | Anti PIGK pAb (ATL-HPA057040) at Atlas Antibodies |
| Documents & Links for Anti PIGK pAb (ATL-HPA057040) | |
| Datasheet | Anti PIGK pAb (ATL-HPA057040) Datasheet (External Link) |
| Vendor Page | Anti PIGK pAb (ATL-HPA057040) |