Anti PIGK pAb (ATL-HPA056383)

Atlas Antibodies

Catalog No.:
ATL-HPA056383-25
Shipping:
Calculated at Checkout
$478.00
Adding to cart… The item has been added
Protein Description: phosphatidylinositol glycan anchor biosynthesis, class K
Gene Name: PIGK
Alternative Gene Name: GPI8, hGPI8
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000039047: 81%, ENSRNOG00000042359: 82%
Entrez Gene ID: 10026
Uniprot ID: Q92643
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen CVSTPGHRTDLFQRDPKNVLITDFFGSVRKVEITTETIKLQQDSEIMESSYKEDQMDEKLMEPLKYAEQLPVAQIIHQKPKLKD
Gene Sequence CVSTPGHRTDLFQRDPKNVLITDFFGSVRKVEITTETIKLQQDSEIMESSYKEDQMDEKLMEPLKYAEQLPVAQIIHQKPKLKD
Gene ID - Mouse ENSMUSG00000039047
Gene ID - Rat ENSRNOG00000042359
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti PIGK pAb (ATL-HPA056383)
Datasheet Anti PIGK pAb (ATL-HPA056383) Datasheet (External Link)
Vendor Page Anti PIGK pAb (ATL-HPA056383) at Atlas Antibodies

Documents & Links for Anti PIGK pAb (ATL-HPA056383)
Datasheet Anti PIGK pAb (ATL-HPA056383) Datasheet (External Link)
Vendor Page Anti PIGK pAb (ATL-HPA056383)