Anti PIDD1 pAb (ATL-HPA066948)
Atlas Antibodies
- Catalog No.:
- ATL-HPA066948-25
- Shipping:
- Calculated at Checkout
$447.00
Gene Name: PIDD1
Alternative Gene Name: DKFZp434D229, LRDD, MGC16925, PIDD
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000025507: 84%, ENSRNOG00000018710: 86%
Entrez Gene ID: 55367
Uniprot ID: Q9HB75
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | GVSYREVQRIRHEFRDDLDEQIRHMLFSWAERQAGQPGAVGLLVQALEQSDRQDVAEEVRAVLELGRRKYQDSIRRMGLA |
Gene Sequence | GVSYREVQRIRHEFRDDLDEQIRHMLFSWAERQAGQPGAVGLLVQALEQSDRQDVAEEVRAVLELGRRKYQDSIRRMGLA |
Gene ID - Mouse | ENSMUSG00000025507 |
Gene ID - Rat | ENSRNOG00000018710 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti PIDD1 pAb (ATL-HPA066948) | |
Datasheet | Anti PIDD1 pAb (ATL-HPA066948) Datasheet (External Link) |
Vendor Page | Anti PIDD1 pAb (ATL-HPA066948) at Atlas Antibodies |
Documents & Links for Anti PIDD1 pAb (ATL-HPA066948) | |
Datasheet | Anti PIDD1 pAb (ATL-HPA066948) Datasheet (External Link) |
Vendor Page | Anti PIDD1 pAb (ATL-HPA066948) |