Anti PIDD1 pAb (ATL-HPA066948)

Atlas Antibodies

Catalog No.:
ATL-HPA066948-25
Shipping:
Calculated at Checkout
$478.00
Adding to cart… The item has been added
Protein Description: p53-induced death domain protein 1
Gene Name: PIDD1
Alternative Gene Name: DKFZp434D229, LRDD, MGC16925, PIDD
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000025507: 84%, ENSRNOG00000018710: 86%
Entrez Gene ID: 55367
Uniprot ID: Q9HB75
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen GVSYREVQRIRHEFRDDLDEQIRHMLFSWAERQAGQPGAVGLLVQALEQSDRQDVAEEVRAVLELGRRKYQDSIRRMGLA
Gene Sequence GVSYREVQRIRHEFRDDLDEQIRHMLFSWAERQAGQPGAVGLLVQALEQSDRQDVAEEVRAVLELGRRKYQDSIRRMGLA
Gene ID - Mouse ENSMUSG00000025507
Gene ID - Rat ENSRNOG00000018710
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti PIDD1 pAb (ATL-HPA066948)
Datasheet Anti PIDD1 pAb (ATL-HPA066948) Datasheet (External Link)
Vendor Page Anti PIDD1 pAb (ATL-HPA066948) at Atlas Antibodies

Documents & Links for Anti PIDD1 pAb (ATL-HPA066948)
Datasheet Anti PIDD1 pAb (ATL-HPA066948) Datasheet (External Link)
Vendor Page Anti PIDD1 pAb (ATL-HPA066948)