Anti PICK1 pAb (ATL-HPA072674)

Atlas Antibodies

SKU:
ATL-HPA072674-25
  • Immunohistochemical staining of human testis shows strong cytoplsamic positivity in a subset of cells in seminiferous ducts.
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: protein interacting with PRKCA 1
Gene Name: PICK1
Alternative Gene Name: dJ1039K5, MGC15204, PRKCABP
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000068206: 99%, ENSRNOG00000011507: 100%
Entrez Gene ID: 9463
Uniprot ID: Q9NRD5
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen IEEDKLGIPTVPGKVTLQKDAQNLIGISIGGGAQYCPCLYIVQVFDNTPAALDGTVAAGDEITGVNGRSIKGKTKVEVAKMIQEVKGEVTIHYNKLQADPKQGMSLDIVLKKVKHRLVENMSSGTADALGLSRAILCNDGLVKRLEELERTA
Gene Sequence IEEDKLGIPTVPGKVTLQKDAQNLIGISIGGGAQYCPCLYIVQVFDNTPAALDGTVAAGDEITGVNGRSIKGKTKVEVAKMIQEVKGEVTIHYNKLQADPKQGMSLDIVLKKVKHRLVENMSSGTADALGLSRAILCNDGLVKRLEELERTA
Gene ID - Mouse ENSMUSG00000068206
Gene ID - Rat ENSRNOG00000011507
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti PICK1 pAb (ATL-HPA072674)
Datasheet Anti PICK1 pAb (ATL-HPA072674) Datasheet (External Link)
Vendor Page Anti PICK1 pAb (ATL-HPA072674) at Atlas Antibodies

Documents & Links for Anti PICK1 pAb (ATL-HPA072674)
Datasheet Anti PICK1 pAb (ATL-HPA072674) Datasheet (External Link)
Vendor Page Anti PICK1 pAb (ATL-HPA072674)