Anti PIBF1 pAb (ATL-HPA052269)

Atlas Antibodies

Catalog No.:
ATL-HPA052269-25
Shipping:
Calculated at Checkout
$324.00
Adding to cart… The item has been added
Protein Description: progesterone immunomodulatory binding factor 1
Gene Name: PIBF1
Alternative Gene Name: C13orf24, CEP90
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000022064: 91%, ENSRNOG00000009208: 91%
Entrez Gene ID: 10464
Uniprot ID: Q8WXW3
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen QELMKQEMETILLRQKQLEETNLQLREKAGDVRRNLRDFELTEEQYIKLKAFPEDQLSIPEYVSVRFYELVNPLRKEICELQVKKNILAEELSTNK
Gene Sequence QELMKQEMETILLRQKQLEETNLQLREKAGDVRRNLRDFELTEEQYIKLKAFPEDQLSIPEYVSVRFYELVNPLRKEICELQVKKNILAEELSTNK
Gene ID - Mouse ENSMUSG00000022064
Gene ID - Rat ENSRNOG00000009208
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti PIBF1 pAb (ATL-HPA052269)
Datasheet Anti PIBF1 pAb (ATL-HPA052269) Datasheet (External Link)
Vendor Page Anti PIBF1 pAb (ATL-HPA052269) at Atlas Antibodies

Documents & Links for Anti PIBF1 pAb (ATL-HPA052269)
Datasheet Anti PIBF1 pAb (ATL-HPA052269) Datasheet (External Link)
Vendor Page Anti PIBF1 pAb (ATL-HPA052269)