Anti PIAS4 pAb (ATL-HPA076008)
Atlas Antibodies
- Catalog No.:
- ATL-HPA076008-25
- Shipping:
- Calculated at Checkout
$395.00
Gene Name: PIAS4
Alternative Gene Name: FLJ12419, Piasg, PIASY, ZMIZ6
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000004934: 79%, ENSRNOG00000020230: 80%
Entrez Gene ID: 51588
Uniprot ID: Q8N2W9
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | WB |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | PYDQLIIDGLLSKILSECEDADEIEYLVDGSWCPIRAEKERSCSPQGAILVLGPSDANGLLPAPSVNGSGA |
| Gene Sequence | PYDQLIIDGLLSKILSECEDADEIEYLVDGSWCPIRAEKERSCSPQGAILVLGPSDANGLLPAPSVNGSGA |
| Gene ID - Mouse | ENSMUSG00000004934 |
| Gene ID - Rat | ENSRNOG00000020230 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti PIAS4 pAb (ATL-HPA076008) | |
| Datasheet | Anti PIAS4 pAb (ATL-HPA076008) Datasheet (External Link) |
| Vendor Page | Anti PIAS4 pAb (ATL-HPA076008) at Atlas Antibodies |
| Documents & Links for Anti PIAS4 pAb (ATL-HPA076008) | |
| Datasheet | Anti PIAS4 pAb (ATL-HPA076008) Datasheet (External Link) |
| Vendor Page | Anti PIAS4 pAb (ATL-HPA076008) |