Anti PIAS4 pAb (ATL-HPA076008)

Atlas Antibodies

Catalog No.: ATL-HPA076008-25

Protein Description: protein inhibitor of activated STAT 4
Gene Name: PIAS4
Alternative Gene Name: FLJ12419, Piasg, PIASY, ZMIZ6
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000004934: 79%, ENSRNOG00000020230: 80%
Entrez Gene ID: 51588
Uniprot ID: Q8N2W9
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: PYDQLIIDGLLSKILSECEDADEIEYLVDGSWCPIRAEKERSCSPQGAILVLGPSDANGLLPAPSVNGSGA
• Gene Sequence: PYDQLIIDGLLSKILSECEDADEIEYLVDGSWCPIRAEKERSCSPQGAILVLGPSDANGLLPAPSVNGSGA
• Gene ID - Mouse: ENSMUSG00000004934
• Gene ID - Rat: ENSRNOG00000020230
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.