Anti PIANP pAb (ATL-HPA010631 w/enhanced validation)

Atlas Antibodies

Catalog No.: ATL-HPA010631-25

Protein Description: PILR alpha associated neural protein
Gene Name: PIANP
Alternative Gene Name: C12orf53, DKFZp547D2210, PANP
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000030329: 99%, ENSRNOG00000017052: 99%
Entrez Gene ID: 196500
Uniprot ID: Q8IYJ0
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: DRSQKRRRPSGQQGALRQEESQQPLTDLSPAGVTVLGAFGDSPTPTPDHEEPRGGPRPGMPHPKGAPAFQLNR
• Gene Sequence: DRSQKRRRPSGQQGALRQEESQQPLTDLSPAGVTVLGAFGDSPTPTPDHEEPRGGPRPGMPHPKGAPAFQLNR
• Gene ID - Mouse: ENSMUSG00000030329
• Gene ID - Rat: ENSRNOG00000017052
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.