Anti PI3 pAb (ATL-HPA017737 w/enhanced validation)

Atlas Antibodies

Catalog No.: ATL-HPA017737-25

Protein Description: peptidase inhibitor 3, skin-derived
Gene Name: PI3
Alternative Gene Name: cementoin, ELAFIN, ESI, SKALP, WAP3, WFDC14
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000017002: 31%, ENSRNOG00000046699: 31%
Entrez Gene ID: 5266
Uniprot ID: P19957
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: KGQDTVKGRVPFNGQDPVKGQVSVKGQDKVKAQEPVKGPVSTKPGSCPIILIRCAMLNPPNRCLKDTDCPGIKKCCEGSCGMA
• Gene Sequence: KGQDTVKGRVPFNGQDPVKGQVSVKGQDKVKAQEPVKGPVSTKPGSCPIILIRCAMLNPPNRCLKDTDCPGIKKCCEGSCGMA
• Gene ID - Mouse: ENSMUSG00000017002
• Gene ID - Rat: ENSRNOG00000046699
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti PI3 pAb (ATL-HPA017737 w/enhanced validation) – 4 Found

Qundos, Ulrika; Hong, Mun-Gwan; Tybring, Gunnel; Divers, Mark; Odeberg, Jacob; Uhlen, Mathias; Nilsson, Peter; Schwenk, Jochen M. Profiling post-centrifugation delay of serum and plasma with antibody bead arrays. Journal Of Proteomics. 2013;95( 23631827):46-54. 

Hingorani, Sangeeta; Finn, Laura S; Pao, Emily; Lawler, Rick; Schoch, Gary; McDonald, George B; Najafian, Behzad; Sandmaier, Brenda; Gooley, Ted. Urinary elafin and kidney injury in hematopoietic cell transplant recipients. Clinical Journal Of The American Society Of Nephrology : Cjasn. 2015;10(1):12-20. 

Månberg, Anna; Bradley, Frideborg; Qundos, Ulrika; Guthrie, Brandon L; Birse, Kenzie; Noël-Romas, Laura; Lindskog, Cecilia; Bosire, Rose; Kiarie, James; Farquhar, Carey; Burgener, Adam D; Nilsson, Peter; Broliden, Kristina. A High-throughput Bead-based Affinity Assay Enables Analysis of Genital Protein Signatures in Women At Risk of HIV Infection. Molecular & Cellular Proteomics : Mcp. 2019;18(3):461-476. 

Wang, Jiani; Ortiz, Christina; Fontenot, Lindsey; Xie, Ying; Ho, Wendy; Mattai, S Anjani; Shih, David Q; Koon, Hon Wai. High circulating elafin levels are associated with Crohn's disease-associated intestinal strictures. Plos One. 15(4):e0231796.