Anti PI15 pAb (ATL-HPA030057)

Atlas Antibodies

Catalog No.:
ATL-HPA030057-25
Shipping:
Calculated at Checkout
$478.00
Adding to cart… The item has been added
Protein Description: peptidase inhibitor 15
Gene Name: PI15
Alternative Gene Name: P25TI
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000067780: 98%, ENSRNOG00000017686: 98%
Entrez Gene ID: 51050
Uniprot ID: O43692
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen PQDCNPRCPMRCFGPMCTHYTQMVWATSNRIGCAIHTCQNMNVWGSVWRRAVYLVCNYAPKGNWIGEAPYKVGVPCSSCPPSYGGSCTDNLCFPGVTSNYLY
Gene Sequence PQDCNPRCPMRCFGPMCTHYTQMVWATSNRIGCAIHTCQNMNVWGSVWRRAVYLVCNYAPKGNWIGEAPYKVGVPCSSCPPSYGGSCTDNLCFPGVTSNYLY
Gene ID - Mouse ENSMUSG00000067780
Gene ID - Rat ENSRNOG00000017686
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti PI15 pAb (ATL-HPA030057)
Datasheet Anti PI15 pAb (ATL-HPA030057) Datasheet (External Link)
Vendor Page Anti PI15 pAb (ATL-HPA030057) at Atlas Antibodies

Documents & Links for Anti PI15 pAb (ATL-HPA030057)
Datasheet Anti PI15 pAb (ATL-HPA030057) Datasheet (External Link)
Vendor Page Anti PI15 pAb (ATL-HPA030057)