Anti PHPT1 pAb (ATL-HPA020952)

Atlas Antibodies

Catalog No.:
ATL-HPA020952-25
Shipping:
Calculated at Checkout
$478.00
Adding to cart… The item has been added
Protein Description: phosphohistidine phosphatase 1
Gene Name: PHPT1
Alternative Gene Name: bA216L13.10, CGI-202, DKFZp564M173, HSPC141, PHP14
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000036504: 84%, ENSRNOG00000016723: 84%
Entrez Gene ID: 29085
Uniprot ID: Q9NRX4
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen DLALIPDVDIDSDGVFKYVLIRVHSAPRSGAPAAESKEIVRGYKWAEYHADIYDKVSGDMQKQGCDCECLGGGRISHQSQDKKIHVYGYSMAYGPAQHAISTEKIKAKYPDYE
Gene Sequence DLALIPDVDIDSDGVFKYVLIRVHSAPRSGAPAAESKEIVRGYKWAEYHADIYDKVSGDMQKQGCDCECLGGGRISHQSQDKKIHVYGYSMAYGPAQHAISTEKIKAKYPDYE
Gene ID - Mouse ENSMUSG00000036504
Gene ID - Rat ENSRNOG00000016723
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti PHPT1 pAb (ATL-HPA020952)
Datasheet Anti PHPT1 pAb (ATL-HPA020952) Datasheet (External Link)
Vendor Page Anti PHPT1 pAb (ATL-HPA020952) at Atlas Antibodies

Documents & Links for Anti PHPT1 pAb (ATL-HPA020952)
Datasheet Anti PHPT1 pAb (ATL-HPA020952) Datasheet (External Link)
Vendor Page Anti PHPT1 pAb (ATL-HPA020952)
Citations for Anti PHPT1 pAb (ATL-HPA020952) – 1 Found
Stadler, Charlotte; Rexhepaj, Elton; Singan, Vasanth R; Murphy, Robert F; Pepperkok, Rainer; Uhlén, Mathias; Simpson, Jeremy C; Lundberg, Emma. Immunofluorescence and fluorescent-protein tagging show high correlation for protein localization in mammalian cells. Nature Methods. 2013;10(4):315-23.  PubMed