Anti PHOX2B pAb (ATL-HPA074325)

Atlas Antibodies

Catalog No.:
ATL-HPA074325-25
Shipping:
Calculated at Checkout
$303.00
Adding to cart… The item has been added
Protein Description: paired-like homeobox 2b
Gene Name: PHOX2B
Alternative Gene Name: NBPhox, Phox2b, PMX2B
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000012520: 100%, ENSRNOG00000051929: 100%
Entrez Gene ID: 8929
Uniprot ID: Q99453
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen GPGQGWAPGPGPITSIPDSLGGPFASVLSSLQRPN
Gene Sequence GPGQGWAPGPGPITSIPDSLGGPFASVLSSLQRPN
Gene ID - Mouse ENSMUSG00000012520
Gene ID - Rat ENSRNOG00000051929
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti PHOX2B pAb (ATL-HPA074325)
Datasheet Anti PHOX2B pAb (ATL-HPA074325) Datasheet (External Link)
Vendor Page Anti PHOX2B pAb (ATL-HPA074325) at Atlas Antibodies

Documents & Links for Anti PHOX2B pAb (ATL-HPA074325)
Datasheet Anti PHOX2B pAb (ATL-HPA074325) Datasheet (External Link)
Vendor Page Anti PHOX2B pAb (ATL-HPA074325)