Anti PHOX2A pAb (ATL-HPA065621)

Atlas Antibodies

Catalog No.:
ATL-HPA065621-25
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: paired-like homeobox 2a
Gene Name: PHOX2A
Alternative Gene Name: ARIX, CFEOM2, FEOM2, PMX2A
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000007946: 97%, ENSRNOG00000019706: 97%
Entrez Gene ID: 401
Uniprot ID: O14813
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen AAELLKAWQPAESGPGPFSGVLSSFHRKPGPALKTNLF
Gene Sequence AAELLKAWQPAESGPGPFSGVLSSFHRKPGPALKTNLF
Gene ID - Mouse ENSMUSG00000007946
Gene ID - Rat ENSRNOG00000019706
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti PHOX2A pAb (ATL-HPA065621)
Datasheet Anti PHOX2A pAb (ATL-HPA065621) Datasheet (External Link)
Vendor Page Anti PHOX2A pAb (ATL-HPA065621) at Atlas Antibodies

Documents & Links for Anti PHOX2A pAb (ATL-HPA065621)
Datasheet Anti PHOX2A pAb (ATL-HPA065621) Datasheet (External Link)
Vendor Page Anti PHOX2A pAb (ATL-HPA065621)