Anti PHLPP2 pAb (ATL-HPA041837)

Atlas Antibodies

Catalog No.:
ATL-HPA041837-25
Shipping:
Calculated at Checkout
$478.00
Adding to cart… The item has been added
Protein Description: PH domain and leucine rich repeat protein phosphatase 2
Gene Name: PHLPP2
Alternative Gene Name: KIAA0931, PHLPPL, PPM3B
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000031732: 89%, ENSRNOG00000016108: 87%
Entrez Gene ID: 23035
Uniprot ID: Q6ZVD8
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen LRMNHLKTMVIENLEGNKHITHVDLRDNRLTDLDLSSLCSLEQLHCGRNQLRELTLSGFSLRTLYASSNR
Gene Sequence LRMNHLKTMVIENLEGNKHITHVDLRDNRLTDLDLSSLCSLEQLHCGRNQLRELTLSGFSLRTLYASSNR
Gene ID - Mouse ENSMUSG00000031732
Gene ID - Rat ENSRNOG00000016108
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti PHLPP2 pAb (ATL-HPA041837)
Datasheet Anti PHLPP2 pAb (ATL-HPA041837) Datasheet (External Link)
Vendor Page Anti PHLPP2 pAb (ATL-HPA041837) at Atlas Antibodies

Documents & Links for Anti PHLPP2 pAb (ATL-HPA041837)
Datasheet Anti PHLPP2 pAb (ATL-HPA041837) Datasheet (External Link)
Vendor Page Anti PHLPP2 pAb (ATL-HPA041837)