Anti PHLDB1 pAb (ATL-HPA061506)

Atlas Antibodies

Catalog No.: ATL-HPA061506-25

Protein Description: pleckstrin homology-like domain, family B, member 1
Gene Name: PHLDB1
Alternative Gene Name: FLJ00141, KIAA0638, LL5a
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000048537: 94%, ENSRNOG00000026985: 95%
Entrez Gene ID: 23187
Uniprot ID: Q86UU1
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: GTLTLYPCGNACTIDGLPVRQPTRLTQGCMLCLGQSTFLRFNHPAEAKWMKSMIPAGGRAPGPPYSPVPAESESLVNGNHT
• Gene Sequence: GTLTLYPCGNACTIDGLPVRQPTRLTQGCMLCLGQSTFLRFNHPAEAKWMKSMIPAGGRAPGPPYSPVPAESESLVNGNHT
• Gene ID - Mouse: ENSMUSG00000048537
• Gene ID - Rat: ENSRNOG00000026985
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.