Anti PHLDA1 pAb (ATL-HPA063520)

Atlas Antibodies

Catalog No.:
ATL-HPA063520-25
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: pleckstrin homology-like domain, family A, member 1
Gene Name: PHLDA1
Alternative Gene Name: DT1P1B11, PHRIP, TDAG51
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000020205: 98%, ENSRNOG00000004019: 100%
Entrez Gene ID: 22822
Uniprot ID: Q8WV24
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen KGKYMYFTVVMAEGKEIDFRCPQDQGWNAEITLQMVQYKNRQAILAVKSTRQKQQHLVQQQP
Gene Sequence KGKYMYFTVVMAEGKEIDFRCPQDQGWNAEITLQMVQYKNRQAILAVKSTRQKQQHLVQQQP
Gene ID - Mouse ENSMUSG00000020205
Gene ID - Rat ENSRNOG00000004019
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti PHLDA1 pAb (ATL-HPA063520)
Datasheet Anti PHLDA1 pAb (ATL-HPA063520) Datasheet (External Link)
Vendor Page Anti PHLDA1 pAb (ATL-HPA063520) at Atlas Antibodies

Documents & Links for Anti PHLDA1 pAb (ATL-HPA063520)
Datasheet Anti PHLDA1 pAb (ATL-HPA063520) Datasheet (External Link)
Vendor Page Anti PHLDA1 pAb (ATL-HPA063520)