Anti PHKG2 pAb (ATL-HPA068751 w/enhanced validation)

Atlas Antibodies

Catalog No.:
ATL-HPA068751-25
Shipping:
Calculated at Checkout
$478.00
Adding to cart… The item has been added
Protein Description: phosphorylase kinase, gamma 2 (testis)
Gene Name: PHKG2
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000030815: 72%, ENSRNOG00000018725: 69%
Entrez Gene ID: 5261
Uniprot ID: P15735
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen QNRAALFQHRPPGPFPIMGPEEEGDSAAITEDEAVLVLG
Gene Sequence QNRAALFQHRPPGPFPIMGPEEEGDSAAITEDEAVLVLG
Gene ID - Mouse ENSMUSG00000030815
Gene ID - Rat ENSRNOG00000018725
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti PHKG2 pAb (ATL-HPA068751 w/enhanced validation)
Datasheet Anti PHKG2 pAb (ATL-HPA068751 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti PHKG2 pAb (ATL-HPA068751 w/enhanced validation) at Atlas Antibodies

Documents & Links for Anti PHKG2 pAb (ATL-HPA068751 w/enhanced validation)
Datasheet Anti PHKG2 pAb (ATL-HPA068751 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti PHKG2 pAb (ATL-HPA068751 w/enhanced validation)