Anti PHKG2 pAb (ATL-HPA068751 w/enhanced validation)

Atlas Antibodies

SKU: ATL-HPA068751-25

• 
• 

Protein Description: phosphorylase kinase, gamma 2 (testis)
Gene Name: PHKG2
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000030815: 72%, ENSRNOG00000018725: 69%
Entrez Gene ID: 5261
Uniprot ID: P15735
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: QNRAALFQHRPPGPFPIMGPEEEGDSAAITEDEAVLVLG
• Gene Sequence: QNRAALFQHRPPGPFPIMGPEEEGDSAAITEDEAVLVLG
• Gene ID - Mouse: ENSMUSG00000030815
• Gene ID - Rat: ENSRNOG00000018725
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.