Anti PHF8 pAb (ATL-HPA062015)

Atlas Antibodies

Catalog No.:
ATL-HPA062015-25
Shipping:
Calculated at Checkout
$303.00
Adding to cart… The item has been added
Protein Description: PHD finger protein 8
Gene Name: PHF8
Alternative Gene Name: JHDM1F, KIAA1111, ZNF422
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000041229: 93%, ENSRNOG00000002708: 92%
Entrez Gene ID: 23133
Uniprot ID: Q9UPP1
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen KATLIIRPKFPRKLPRAKPCSDPNRVREPGEVEFDIEEDYTTDEDMVEGVEGKLGNGSGAGGILDLLKASRQ
Gene Sequence KATLIIRPKFPRKLPRAKPCSDPNRVREPGEVEFDIEEDYTTDEDMVEGVEGKLGNGSGAGGILDLLKASRQ
Gene ID - Mouse ENSMUSG00000041229
Gene ID - Rat ENSRNOG00000002708
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti PHF8 pAb (ATL-HPA062015)
Datasheet Anti PHF8 pAb (ATL-HPA062015) Datasheet (External Link)
Vendor Page Anti PHF8 pAb (ATL-HPA062015) at Atlas Antibodies

Documents & Links for Anti PHF8 pAb (ATL-HPA062015)
Datasheet Anti PHF8 pAb (ATL-HPA062015) Datasheet (External Link)
Vendor Page Anti PHF8 pAb (ATL-HPA062015)