Anti PHF8 pAb (ATL-HPA062015)
Atlas Antibodies
- Catalog No.:
- ATL-HPA062015-25
- Shipping:
- Calculated at Checkout
$303.00
Gene Name: PHF8
Alternative Gene Name: JHDM1F, KIAA1111, ZNF422
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000041229: 93%, ENSRNOG00000002708: 92%
Entrez Gene ID: 23133
Uniprot ID: Q9UPP1
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | ICC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | KATLIIRPKFPRKLPRAKPCSDPNRVREPGEVEFDIEEDYTTDEDMVEGVEGKLGNGSGAGGILDLLKASRQ |
Gene Sequence | KATLIIRPKFPRKLPRAKPCSDPNRVREPGEVEFDIEEDYTTDEDMVEGVEGKLGNGSGAGGILDLLKASRQ |
Gene ID - Mouse | ENSMUSG00000041229 |
Gene ID - Rat | ENSRNOG00000002708 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti PHF8 pAb (ATL-HPA062015) | |
Datasheet | Anti PHF8 pAb (ATL-HPA062015) Datasheet (External Link) |
Vendor Page | Anti PHF8 pAb (ATL-HPA062015) at Atlas Antibodies |
Documents & Links for Anti PHF8 pAb (ATL-HPA062015) | |
Datasheet | Anti PHF8 pAb (ATL-HPA062015) Datasheet (External Link) |
Vendor Page | Anti PHF8 pAb (ATL-HPA062015) |