Anti PHF6 pAb (ATL-HPA001023 w/enhanced validation)
Atlas Antibodies
- Catalog No.:
- ATL-HPA001023-25
- Shipping:
- Calculated at Checkout
$324.00
Gene Name: PHF6
Alternative Gene Name: BFLS, BORJ, CENP-31, KIAA1823, MGC14797
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000025626: 98%, ENSRNOG00000002276: 98%
Entrez Gene ID: 84295
Uniprot ID: Q8IWS0
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | WB, ICC, IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | MSSSVEQKKGPTRQRKCGFCKSNRDKECGQLLISENQKVAAHHKCMLFSSALVSSHSDNESLGGFSIEDVQKEIKRGTKLMCSLCHCPGATIGCDVKTCHRTYHYHCALHDK |
| Gene Sequence | MSSSVEQKKGPTRQRKCGFCKSNRDKECGQLLISENQKVAAHHKCMLFSSALVSSHSDNESLGGFSIEDVQKEIKRGTKLMCSLCHCPGATIGCDVKTCHRTYHYHCALHDK |
| Gene ID - Mouse | ENSMUSG00000025626 |
| Gene ID - Rat | ENSRNOG00000002276 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti PHF6 pAb (ATL-HPA001023 w/enhanced validation) | |
| Datasheet | Anti PHF6 pAb (ATL-HPA001023 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti PHF6 pAb (ATL-HPA001023 w/enhanced validation) at Atlas Antibodies |
| Documents & Links for Anti PHF6 pAb (ATL-HPA001023 w/enhanced validation) | |
| Datasheet | Anti PHF6 pAb (ATL-HPA001023 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti PHF6 pAb (ATL-HPA001023 w/enhanced validation) |
| Citations for Anti PHF6 pAb (ATL-HPA001023 w/enhanced validation) – 5 Found |
| Pontén, F; Jirström, K; Uhlen, M. The Human Protein Atlas--a tool for pathology. The Journal Of Pathology. 2008;216(4):387-93. PubMed |
| Wendorff, Agnieszka A; Quinn, S Aidan; Rashkovan, Marissa; Madubata, Chioma J; Ambesi-Impiombato, Alberto; Litzow, Mark R; Tallman, Martin S; Paietta, Elisabeth; Paganin, Maddalena; Basso, Giuseppe; Gastier-Foster, Julie M; Loh, Mignon L; Rabadan, Raul; Van Vlierberghe, Pieter; Ferrando, Adolfo A. Phf6 Loss Enhances HSC Self-Renewal Driving Tumor Initiation and Leukemia Stem Cell Activity in T-ALL. Cancer Discovery. 2019;9(3):436-451. PubMed |
| Fliedner, Anna; Gregor, Anne; Ferrazzi, Fulvia; Ekici, Arif B; Sticht, Heinrich; Zweier, Christiane. Loss of PHF6 leads to aberrant development of human neuron-like cells. Scientific Reports. 2020;10(1):19030. PubMed |
| Yuan, Shengnan; Wang, Xiaomin; Hou, Shuaibing; Guo, Tengxiao; Lan, Yanjie; Yang, Shuang; Zhao, Fei; Gao, Juan; Wang, Yuxia; Chu, Yajing; Shi, Jun; Cheng, Tao; Yuan, Weiping. PHF6 and JAK3 mutations cooperate to drive T-cell acute lymphoblastic leukemia progression. Leukemia. 2022;36(2):370-382. PubMed |
| Ahmed, Raies; Sarwar, Shihab; Hu, Jinghua; Cardin, Valérie; Qiu, Lily R; Zapata, Gerardo; Vandeleur, Lucianne; Yan, Keqin; Lerch, Jason P; Corbett, Mark A; Gecz, Jozef; Picketts, David J. Transgenic mice with an R342X mutation in Phf6 display clinical features of Börjeson-Forssman-Lehmann Syndrome. Human Molecular Genetics. 2021;30(7):575-594. PubMed |