Anti PHF6 pAb (ATL-HPA001023 w/enhanced validation)

Atlas Antibodies

Catalog No.:
ATL-HPA001023-25
Shipping:
Calculated at Checkout
$324.00
Adding to cart… The item has been added
Protein Description: PHD finger protein 6
Gene Name: PHF6
Alternative Gene Name: BFLS, BORJ, CENP-31, KIAA1823, MGC14797
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000025626: 98%, ENSRNOG00000002276: 98%
Entrez Gene ID: 84295
Uniprot ID: Q8IWS0
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen MSSSVEQKKGPTRQRKCGFCKSNRDKECGQLLISENQKVAAHHKCMLFSSALVSSHSDNESLGGFSIEDVQKEIKRGTKLMCSLCHCPGATIGCDVKTCHRTYHYHCALHDK
Gene Sequence MSSSVEQKKGPTRQRKCGFCKSNRDKECGQLLISENQKVAAHHKCMLFSSALVSSHSDNESLGGFSIEDVQKEIKRGTKLMCSLCHCPGATIGCDVKTCHRTYHYHCALHDK
Gene ID - Mouse ENSMUSG00000025626
Gene ID - Rat ENSRNOG00000002276
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti PHF6 pAb (ATL-HPA001023 w/enhanced validation)
Datasheet Anti PHF6 pAb (ATL-HPA001023 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti PHF6 pAb (ATL-HPA001023 w/enhanced validation) at Atlas Antibodies

Documents & Links for Anti PHF6 pAb (ATL-HPA001023 w/enhanced validation)
Datasheet Anti PHF6 pAb (ATL-HPA001023 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti PHF6 pAb (ATL-HPA001023 w/enhanced validation)
Citations for Anti PHF6 pAb (ATL-HPA001023 w/enhanced validation) – 5 Found
Pontén, F; Jirström, K; Uhlen, M. The Human Protein Atlas--a tool for pathology. The Journal Of Pathology. 2008;216(4):387-93.  PubMed
Wendorff, Agnieszka A; Quinn, S Aidan; Rashkovan, Marissa; Madubata, Chioma J; Ambesi-Impiombato, Alberto; Litzow, Mark R; Tallman, Martin S; Paietta, Elisabeth; Paganin, Maddalena; Basso, Giuseppe; Gastier-Foster, Julie M; Loh, Mignon L; Rabadan, Raul; Van Vlierberghe, Pieter; Ferrando, Adolfo A. Phf6 Loss Enhances HSC Self-Renewal Driving Tumor Initiation and Leukemia Stem Cell Activity in T-ALL. Cancer Discovery. 2019;9(3):436-451.  PubMed
Fliedner, Anna; Gregor, Anne; Ferrazzi, Fulvia; Ekici, Arif B; Sticht, Heinrich; Zweier, Christiane. Loss of PHF6 leads to aberrant development of human neuron-like cells. Scientific Reports. 2020;10(1):19030.  PubMed
Yuan, Shengnan; Wang, Xiaomin; Hou, Shuaibing; Guo, Tengxiao; Lan, Yanjie; Yang, Shuang; Zhao, Fei; Gao, Juan; Wang, Yuxia; Chu, Yajing; Shi, Jun; Cheng, Tao; Yuan, Weiping. PHF6 and JAK3 mutations cooperate to drive T-cell acute lymphoblastic leukemia progression. Leukemia. 2022;36(2):370-382.  PubMed
Ahmed, Raies; Sarwar, Shihab; Hu, Jinghua; Cardin, Valérie; Qiu, Lily R; Zapata, Gerardo; Vandeleur, Lucianne; Yan, Keqin; Lerch, Jason P; Corbett, Mark A; Gecz, Jozef; Picketts, David J. Transgenic mice with an R342X mutation in Phf6 display clinical features of Börjeson-Forssman-Lehmann Syndrome. Human Molecular Genetics. 2021;30(7):575-594.  PubMed