Anti PHF3 pAb (ATL-HPA024676)

Atlas Antibodies

Catalog No.:
ATL-HPA024676-25
Shipping:
Calculated at Checkout
$478.00
Adding to cart… The item has been added
Protein Description: PHD finger protein 3
Gene Name: PHF3
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000048874: 54%, ENSRNOG00000011756: 45%
Entrez Gene ID: 23469
Uniprot ID: Q92576
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen SKHKCNNPGEIDVPSHELNCSLLSETCVTIGEKKNEALMECKAKPVGSPLFKFSDKEEHEQNDSISGKTGETVVEEMI
Gene Sequence SKHKCNNPGEIDVPSHELNCSLLSETCVTIGEKKNEALMECKAKPVGSPLFKFSDKEEHEQNDSISGKTGETVVEEMI
Gene ID - Mouse ENSMUSG00000048874
Gene ID - Rat ENSRNOG00000011756
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti PHF3 pAb (ATL-HPA024676)
Datasheet Anti PHF3 pAb (ATL-HPA024676) Datasheet (External Link)
Vendor Page Anti PHF3 pAb (ATL-HPA024676) at Atlas Antibodies

Documents & Links for Anti PHF3 pAb (ATL-HPA024676)
Datasheet Anti PHF3 pAb (ATL-HPA024676) Datasheet (External Link)
Vendor Page Anti PHF3 pAb (ATL-HPA024676)