Anti PHF24 pAb (ATL-HPA020974)

Atlas Antibodies

Catalog No.:
ATL-HPA020974-25
Shipping:
Calculated at Checkout
$478.00
Adding to cart… The item has been added
Protein Description: PHD finger protein 24
Gene Name: PHF24
Alternative Gene Name: KIAA1045
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000036062: 89%, ENSRNOG00000000129: 94%
Entrez Gene ID: 23349
Uniprot ID: Q9UPV7
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen LLTEEEMYSLTETFQRCKVIPDCSLTLEDFLRYRHQAAKRGDRDRALSEEQEEQAARQFAALDPEHRGHIEWPDFLSHESLLLLQQLR
Gene Sequence LLTEEEMYSLTETFQRCKVIPDCSLTLEDFLRYRHQAAKRGDRDRALSEEQEEQAARQFAALDPEHRGHIEWPDFLSHESLLLLQQLR
Gene ID - Mouse ENSMUSG00000036062
Gene ID - Rat ENSRNOG00000000129
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti PHF24 pAb (ATL-HPA020974)
Datasheet Anti PHF24 pAb (ATL-HPA020974) Datasheet (External Link)
Vendor Page Anti PHF24 pAb (ATL-HPA020974) at Atlas Antibodies

Documents & Links for Anti PHF24 pAb (ATL-HPA020974)
Datasheet Anti PHF24 pAb (ATL-HPA020974) Datasheet (External Link)
Vendor Page Anti PHF24 pAb (ATL-HPA020974)