Anti PHF20 pAb (ATL-HPA029619)

Atlas Antibodies

Catalog No.:
ATL-HPA029619-25
Shipping:
Calculated at Checkout
$478.00
Adding to cart… The item has been added
Protein Description: PHD finger protein 20
Gene Name: PHF20
Alternative Gene Name: C20orf104, dJ1121G12.1, TDRD20A
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000038116: 90%, ENSRNOG00000019948: 90%
Entrez Gene ID: 51230
Uniprot ID: Q9BVI0
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen VRVKPKKKKKKKKKTKPECPCSEEISDTSQEPSPPKAFAVTRCGSSHKPGVHMSPQLHGPESGHHKGKVKALEEDNLSESSSESFLWSDDEYGQDVDVTTNP
Gene Sequence VRVKPKKKKKKKKKTKPECPCSEEISDTSQEPSPPKAFAVTRCGSSHKPGVHMSPQLHGPESGHHKGKVKALEEDNLSESSSESFLWSDDEYGQDVDVTTNP
Gene ID - Mouse ENSMUSG00000038116
Gene ID - Rat ENSRNOG00000019948
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti PHF20 pAb (ATL-HPA029619)
Datasheet Anti PHF20 pAb (ATL-HPA029619) Datasheet (External Link)
Vendor Page Anti PHF20 pAb (ATL-HPA029619) at Atlas Antibodies

Documents & Links for Anti PHF20 pAb (ATL-HPA029619)
Datasheet Anti PHF20 pAb (ATL-HPA029619) Datasheet (External Link)
Vendor Page Anti PHF20 pAb (ATL-HPA029619)