Anti PHF10 pAb (ATL-HPA055649)

Atlas Antibodies

Catalog No.:
ATL-HPA055649-25
Shipping:
Calculated at Checkout
$324.00
Adding to cart… The item has been added
Protein Description: PHD finger protein 10
Gene Name: PHF10
Alternative Gene Name: BAF45a, FLJ10975, XAP135
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000023883: 90%, ENSRNOG00000061312: 93%
Entrez Gene ID: 55274
Uniprot ID: Q8WUB8
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen GRGDEKRKNKGTSDSSSGNVSEGESPPDSQEDSFQGRQKSKDKAATPRKDGPKRSVLSKSVPGYKPKVI
Gene Sequence GRGDEKRKNKGTSDSSSGNVSEGESPPDSQEDSFQGRQKSKDKAATPRKDGPKRSVLSKSVPGYKPKVI
Gene ID - Mouse ENSMUSG00000023883
Gene ID - Rat ENSRNOG00000061312
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti PHF10 pAb (ATL-HPA055649)
Datasheet Anti PHF10 pAb (ATL-HPA055649) Datasheet (External Link)
Vendor Page Anti PHF10 pAb (ATL-HPA055649) at Atlas Antibodies

Documents & Links for Anti PHF10 pAb (ATL-HPA055649)
Datasheet Anti PHF10 pAb (ATL-HPA055649) Datasheet (External Link)
Vendor Page Anti PHF10 pAb (ATL-HPA055649)