Anti PHF10 pAb (ATL-HPA055649)
Atlas Antibodies
- Catalog No.:
- ATL-HPA055649-25
- Shipping:
- Calculated at Checkout
$303.00
Gene Name: PHF10
Alternative Gene Name: BAF45a, FLJ10975, XAP135
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000023883: 90%, ENSRNOG00000061312: 93%
Entrez Gene ID: 55274
Uniprot ID: Q8WUB8
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | ICC, IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | GRGDEKRKNKGTSDSSSGNVSEGESPPDSQEDSFQGRQKSKDKAATPRKDGPKRSVLSKSVPGYKPKVI |
Gene Sequence | GRGDEKRKNKGTSDSSSGNVSEGESPPDSQEDSFQGRQKSKDKAATPRKDGPKRSVLSKSVPGYKPKVI |
Gene ID - Mouse | ENSMUSG00000023883 |
Gene ID - Rat | ENSRNOG00000061312 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti PHF10 pAb (ATL-HPA055649) | |
Datasheet | Anti PHF10 pAb (ATL-HPA055649) Datasheet (External Link) |
Vendor Page | Anti PHF10 pAb (ATL-HPA055649) at Atlas Antibodies |
Documents & Links for Anti PHF10 pAb (ATL-HPA055649) | |
Datasheet | Anti PHF10 pAb (ATL-HPA055649) Datasheet (External Link) |
Vendor Page | Anti PHF10 pAb (ATL-HPA055649) |