Anti PHF10 pAb (ATL-HPA055649)
Atlas Antibodies
- Catalog No.:
- ATL-HPA055649-25
- Shipping:
- Calculated at Checkout
$324.00
Gene Name: PHF10
Alternative Gene Name: BAF45a, FLJ10975, XAP135
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000023883: 90%, ENSRNOG00000061312: 93%
Entrez Gene ID: 55274
Uniprot ID: Q8WUB8
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | ICC, IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | GRGDEKRKNKGTSDSSSGNVSEGESPPDSQEDSFQGRQKSKDKAATPRKDGPKRSVLSKSVPGYKPKVI |
| Gene Sequence | GRGDEKRKNKGTSDSSSGNVSEGESPPDSQEDSFQGRQKSKDKAATPRKDGPKRSVLSKSVPGYKPKVI |
| Gene ID - Mouse | ENSMUSG00000023883 |
| Gene ID - Rat | ENSRNOG00000061312 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti PHF10 pAb (ATL-HPA055649) | |
| Datasheet | Anti PHF10 pAb (ATL-HPA055649) Datasheet (External Link) |
| Vendor Page | Anti PHF10 pAb (ATL-HPA055649) at Atlas Antibodies |
| Documents & Links for Anti PHF10 pAb (ATL-HPA055649) | |
| Datasheet | Anti PHF10 pAb (ATL-HPA055649) Datasheet (External Link) |
| Vendor Page | Anti PHF10 pAb (ATL-HPA055649) |